powered by:
Protein Alignment Deaf1 and Samd11
DIOPT Version :9
Sequence 1: | NP_001262069.1 |
Gene: | Deaf1 / 40164 |
FlyBaseID: | FBgn0013799 |
Length: | 576 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006538909.1 |
Gene: | Samd11 / 231004 |
MGIID: | 2446220 |
Length: | 558 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 20/72 - (27%) |
Similarity: | 31/72 - (43%) |
Gaps: | 21/72 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 SNDNSG----SGGASGGTS-----GAGGGNG-GGGVVS-------VPVSLPIGSMI----TGTTF 99
|.|:.| :..|..||| .|||... |.|::| :|:..|.|::. |||..
Mouse 339 SKDSDGEDPETAAAREGTSTPSQVPAGGTRAEGRGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMG 403
Fly 100 NVITPDQ 106
.:.|.::
Mouse 404 GLFTDEE 410
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4333 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.