DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and Samd11

DIOPT Version :9

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_006538909.1 Gene:Samd11 / 231004 MGIID:2446220 Length:558 Species:Mus musculus


Alignment Length:72 Identity:20/72 - (27%)
Similarity:31/72 - (43%) Gaps:21/72 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SNDNSG----SGGASGGTS-----GAGGGNG-GGGVVS-------VPVSLPIGSMI----TGTTF 99
            |.|:.|    :..|..|||     .|||... |.|::|       :|:..|.|::.    |||..
Mouse   339 SKDSDGEDPETAAAREGTSTPSQVPAGGTRAEGRGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMG 403

  Fly   100 NVITPDQ 106
            .:.|.::
Mouse   404 GLFTDEE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554
zf-MYND 521..557 CDD:280009
Samd11XP_006538909.1 SAM_Samd7,11 417..484 CDD:188978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.