DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and spe-44

DIOPT Version :9

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_502379.1 Gene:spe-44 / 182915 WormBaseID:WBGene00007732 Length:424 Species:Caenorhabditis elegans


Alignment Length:174 Identity:31/174 - (17%)
Similarity:68/174 - (39%) Gaps:23/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 CVKYKDKWHTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSLIDEGTLT--PHATNCS--CTVCCDD 305
            |::..:...:|.:|.....:...||||.||:.|..||::.::..|:.  .|...||  |      
 Worm   104 CIEVGNDLLSPKQFTIRGDKERQKDWKASIRVGRSSLRTHMEAMTIDFYEHMNRCSGKC------ 162

  Fly   306 EAGESASGPVRLFTPYKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNTSGSGANNCVDVT 370
            ::....:.|.......::.||..     |:|..:....:......::.::|..|...|......:
 Worm   163 QSRNYVNAPSEEVLQARKSKRTS-----EAGQLKYEIENEMAGKEADNDDNRKSAKKARGRPRGS 222

  Fly   371 AAVAAATASVVDENNMFLSE--------ENITSKDEPWAALNDS 406
            .........:..:::.|..|        ::::|.:||.::..:|
 Worm   223 VNKPRQMVKMEPQDDRFFEEFFIDAPPLQSMSSNEEPTSSNKES 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 13/45 (29%)
zf-MYND 521..557 CDD:280009
spe-44NP_502379.1 SAND 77..150 CDD:128554 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I8333
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.