DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Deaf1 and Samd11

DIOPT Version :9

Sequence 1:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_038965039.1 Gene:Samd11 / 102549710 RGDID:1310271 Length:844 Species:Rattus norvegicus


Alignment Length:199 Identity:59/199 - (29%)
Similarity:91/199 - (45%) Gaps:47/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 QIRCKTTCAELYRSKLGSGGRGRCVKYKDKWHTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSLID 286
            ::.|....|.||..||..|.:|..::::.:|.||:||:.|.||.::|||||||::.||||::|:.
  Rat   117 EVECGDNRALLYVRKLCQGSKGPSIRHRGEWLTPNEFQFVSGRETAKDWKRSIRHKGKSLKTLMS 181

  Fly   287 EGTLTPHATNCSCTVCCDDEAGESASGPV---RL-------FTPYKRRKRNQT------DLDME- 334
            :|.|..|...|.|..|       ..|.||   ||       ..|....|:.:|      |.|.: 
  Rat   182 KGILRVHPPICDCPGC-------RISSPVNRGRLADKRTVTLPPTHALKKERTPSFSASDGDSDG 239

  Fly   335 SGP-------------------KRKRNTHHSNNNNSNTNNNNTSGSGANNCVDVTAAVAAATASV 380
            |||                   ||:.:||.    :.|.:...||.|..|:...:.::|..:...|
  Rat   240 SGPACGQQLSLKQEDDPHFHIMKRRVHTHW----DVNISFRETSCSQDNDLPTLISSVHRSRCLV 300

  Fly   381 VDEN 384
            :.|:
  Rat   301 MPEH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Deaf1NP_001262069.1 SAND 219..291 CDD:128554 29/68 (43%)
zf-MYND 521..557 CDD:280009
Samd11XP_038965039.1 SAND 113..185 CDD:396076 29/67 (43%)
SAM_Samd7,11 704..771 CDD:188978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.