DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and CLOCK

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001254772.1 Gene:CLOCK / 9575 HGNCID:2082 Length:846 Species:Homo sapiens


Alignment Length:429 Identity:129/429 - (30%)
Similarity:197/429 - (45%) Gaps:84/429 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CENMEEIED-----------ENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMC 60
            |..|..|.|           |..|::|:.|.|     :|.|  ||:|||:.|..|.||.||:|  
Human     7 CSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVS-----RNKS--EKKRRDQFNVLIKELGSMLP-- 62

  Fly    61 FAMQRKLDKLTVLRMAVQHLR---GIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVV 122
             ...||:||.|||:.::..||   .|.......... .|::|:|||::|...::|:|.:||...:
Human    63 -GNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIR-QDWKPTFLSNEEFTQLMLEALDGFFLAI 125

  Fly   123 GCDRGRILYVSDSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLP 187
            ..| |.|:|||:||:|:|....:||:.||.|:.:...:..:|.:.||:       .|:::.::.|
Human   126 MTD-GSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILST-------HLLESDSLTP 182

  Fly   188 VKTDVPQSLCRLCPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQC 252
            ........|         .|.|.| ||           .|......||           |..::.
Human   183 EYLKSKNQL---------EFCCHM-LR-----------GTIDPKEPST-----------YEYVKF 215

  Fly   253 TGYLKSWTPIKDEDQDA-DSDEQTTNLS------CLVAIGRI--PPNVRN-STVPASLDNHPNIR 307
            .|..||...:.....:. :...|.|:..      |.||..|:  |..::. .||     ..||..
Human   216 IGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTV-----EEPNEE 275

  Fly   308 HVLFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTT 372
               |.||||.|.||||:|.||..:||:||.|:||||.|:|:|.:|:..|.:.|:.:||. .|..:
Human   276 ---FTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQY-GKGKS 336

  Fly   373 QVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSV 411
            ..|||..|...:|.||:.:....:.|.|..::|:..::|
Human   337 CYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 23/55 (42%)
PAS 111..212 CDD:279347 27/100 (27%)
PAS 111..173 CDD:214512 22/61 (36%)
PAS_11 311..411 CDD:291273 41/99 (41%)
PAS 311..406 CDD:238075 40/94 (43%)
CLOCKNP_001254772.1 HLH 32..86 CDD:238036 26/63 (41%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O08785 32..47 7/21 (33%)
PAS 109..>175 CDD:307226 23/73 (32%)
PAS_3 274..377 CDD:330807 42/106 (40%)
Interaction with NR3C1. /evidence=ECO:0000250|UniProtKB:O08785 371..845 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..411
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..495
Interaction with SIRT1. /evidence=ECO:0000250|UniProtKB:O08785 450..570
Med15 <496..>686 CDD:312941
Implicated in the circadian rhythmicity. /evidence=ECO:0000250 514..564
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 624..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..783
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 811..846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.