DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and PER3

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001276791.1 Gene:PER3 / 8863 HGNCID:8847 Length:1210 Species:Homo sapiens


Alignment Length:426 Identity:101/426 - (23%)
Similarity:172/426 - (40%) Gaps:91/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EDENYDEEKSARTSDE---NRK---QNHSEIEKRRR--DKMNTYINELSSMIPMCFAMQRKLDKL 70
            :||...||...|.|.|   .||   .:|||.:.|.|  :::...:.|:....|.  ..:.|...|
Human    15 KDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPS--ERRNKPSTL 77

  Fly    71 TVLRMAVQHLRGIRGSGSLHPFNGSDYRP----SFLSDQELKMIILQASE-------GFLFVVGC 124
            ..|..|::.:..::.:.........:..|    |..|.:||..|   |||       .|:.|...
Human    78 DALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELATI---ASEHTSKNTDTFVAVFSF 139

  Fly   125 DRGRILYVSDSVSSVLNSTQADLLGQSWF-DVLHPKDIGKVKEQLSSLEQCP-----RERLIDAK 183
            ..||::::|:..:.:|| .:.|:|..|.| |:|.|:|: :|....::..|.|     .:|.....
Human   140 LSGRLVHISEQAALILN-RKKDVLASSHFVDLLAPQDM-RVFYAHTARAQLPFWNNWTQRAAARY 202

  Fly   184 TMLPVKTDVPQSLCRLCPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYR 248
            ...|||                .||||::               ....|...|..|      .:|
Human   203 ECAPVK----------------PFFCRIR---------------GGEDRKQEKCHS------PFR 230

  Fly   249 VIQCTGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFIS 313
            :|          |...........|..:...||..:.:|........:|        :...:|.:
Human   231 II----------PYLIHVHHPAQPELESEPCCLTVVEKIHSGYEAPRIP--------VNKRIFTT 277

  Fly   314 RHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQV---PEKVTTQVY 375
            .|:....||.:|::|..::|:|||:::|||...|.|.||.:.::..|:.|::.   |....:.: 
Human   278 THTPGCVFLEVDEKAVPLLGYLPQDLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPI- 341

  Fly   376 RFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSV 411
            ||..::..||.|.|.|.:|.|||:.:|.:||.::.|
Human   342 RFCTQNGDYIILDSSWSSFVNPWSRKISFIIGRHKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 13/57 (23%)
PAS 111..212 CDD:279347 29/113 (26%)
PAS 111..173 CDD:214512 19/69 (28%)
PAS_11 311..411 CDD:291273 34/102 (33%)
PAS 311..406 CDD:238075 32/97 (33%)
PER3NP_001276791.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 13/34 (38%)
Nuclear export signal 1. /evidence=ECO:0000250 55..64 1/8 (13%)
PAS 285..377 CDD:238075 32/92 (35%)
Nuclear export signal 3. /evidence=ECO:0000250 404..413
CSNK1E binding domain. /evidence=ECO:0000250 563..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 725..796
Nuclear localization signal. /evidence=ECO:0000250 737..753
Herpes_BLLF1 <756..1066 CDD:282904
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 889..931
Nuclear export signal 2. /evidence=ECO:0000250 933..940
5 X 18 AA tandem repeats of S-[HP]-[AP]-T-[AT]-[GST]-[ATV]-L-S-[MT]-G-[LS]-P-P-[MRS]- [EKR]-[NST]-P 974..1063
Period_C <1083..1198 CDD:403366
CRY binding domain. /evidence=ECO:0000250 1132..1210
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.