DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and AT3G56770

DIOPT Version :10

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_191236.1 Gene:AT3G56770 / 824844 AraportID:AT3G56770 Length:230 Species:Arabidopsis thaliana


Alignment Length:189 Identity:44/189 - (23%)
Similarity:74/189 - (39%) Gaps:50/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQHLRGI-------------- 83
            :||.|.|::||.::|:::|:|..::    :...|.||.|:|...||.::.:              
plant    47 RNHKEAERKRRARINSHLNKLRKLL----SCNSKTDKSTLLAKVVQRVKELKQQTLEITDETIPS 107

  Fly    84 --------------RGSGSLHPFNGS---DYRPSFLSD--QELKMIILQASEGFLFVVGCDRGRI 129
                          ||......|..|   :.||..|.|  :.||.:.::.....:..||.....:
plant   108 ETDEISVLNIEDCSRGDDRRIIFKVSFCCEDRPELLKDLMETLKSLQMETLFADMTTVGGRTRNV 172

  Fly   130 LYVS-----DSVSSV--LNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLID 181
            |.|:     ..|.||  |.:....||.:|...|:.....|..:|:|.      |.|.:|
plant   173 LVVAADKEHHGVQSVNFLQNALKSLLERSSKSVMVGHGGGGGEERLK------RRRALD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 bHLH_SF 31..92 CDD:469605 18/86 (21%)
PAS 111..173 CDD:214512 15/68 (22%)
PAS_11 311..411 CDD:464214
AT3G56770NP_191236.1 bHLH_AtAIG1_like 39..118 CDD:381461 16/74 (22%)
ACT_UUR-ACR-like 132..198 CDD:153145 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.