DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and NCOA3

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_858045.1 Gene:NCOA3 / 8202 HGNCID:7670 Length:1424 Species:Homo sapiens


Alignment Length:383 Identity:98/383 - (25%)
Similarity:170/383 - (44%) Gaps:77/383 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKRRRDKMNTYINELSSMIPMCFA----MQRKLDKLTVLRMAVQHLRGIRGSGSLHPFNGSDYRP 99
            |||||::.:.||.||:.:|....:    ...|.||..:|:..|:.:|.|:..|.... |..|.:.
Human    34 EKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTIS-NDDDVQK 97

  Fly   100 SFLSD--------QELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVLNSTQADLLGQSWFDVL 156
            :.:|.        ..|..::|||.:||||||..| |.|::||::|:..|...|.||:..|.:::|
Human    98 ADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRD-GNIVFVSENVTQYLQYKQEDLVNTSVYNIL 161

  Fly   157 HPKDIGKVKEQLSSLEQCPRERLIDAKTMLPV----KTDVPQSLCRLCPGARRSFFCRMKLRTAS 217
            |.:|      :...|:..|:      .|:..|    :|...:|         .:|.|||.::|. 
Human   162 HEED------RKDFLKNLPK------STVNGVSWTNETQRQKS---------HTFNCRMLMKTP- 204

  Fly   218 NNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWTPIKDEDQDADSDEQTTNLSCLV 282
             :.|.|:.:.|...|            .:|..:||.. |.....:.:|.:|..        ||::
Human   205 -HDILEDINASPEMR------------QRYETMQCFA-LSQPRAMMEEGEDLQ--------SCMI 247

  Fly   283 AIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFIDQ---RATLVIGFLPQEILGTSF 344
            .:.|     |.:|...:..::|.    .||:||...||.:.||.   |:::..||  ::|:....
Human   248 CVAR-----RITTGERTFPSNPE----SFITRHDLSGKVVNIDTNSLRSSMRPGF--EDIIRRCI 301

  Fly   345 YEYFH-NEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSE 401
            ..:|. |:..:...:.|.....:.....|.||||...|.:.:..|::.:.|:||.|::
Human   302 QRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 16/48 (33%)
PAS 111..212 CDD:279347 32/104 (31%)
PAS 111..173 CDD:214512 24/61 (39%)
PAS_11 311..411 CDD:291273 26/95 (27%)
PAS 311..406 CDD:238075 26/95 (27%)
NCOA3NP_858045.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 3/3 (100%)
HLH 34..88 CDD:197674 18/53 (34%)
PAS 116..173 CDD:214512 24/63 (38%)
PAS 117..215 CDD:279347 36/121 (30%)
PAS_11 265..375 CDD:291273 26/101 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..493
NCOA_u2 459..572 CDD:293270
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 501..520
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..674
SRC-1 620..704 CDD:285981
LXXLL motif 1 685..689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..730
DUF4927 723..810 CDD:292896
LXXLL motif 2 738..742
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 755..798
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..945
Interaction with CREBBP. /evidence=ECO:0000269|PubMed:9346901 1023..1093
Nuc_rec_co-act 1045..1092 CDD:285967
LXXLL motif 3 1057..1061
Acetyltransferase 1097..1304
polyglutamine repeats 1248..1276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1273..1321
DUF1518 1291..1348 CDD:284808
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.