DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and arnt2

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_009301213.1 Gene:arnt2 / 64277 ZFINID:ZDB-GENE-001207-3 Length:738 Species:Danio rerio


Alignment Length:420 Identity:173/420 - (41%)
Similarity:261/420 - (62%) Gaps:40/420 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIEDEN---------YDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKL 67
            :.:||:         ||:::.....:...::||||||:|||:||..||.|||.|:|.|.|:.||.
Zfish    51 DFDDEDGEGPSKFSRYDDDQIPGDKERYARENHSEIERRRRNKMTQYITELSDMVPTCSALARKP 115

  Fly    68 DKLTVLRMAVQHLRGIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYV 132
            ||||:|||||.|::.:||:|:... :|: |:||||::||||.:||:|::||||||..:.||::||
Zfish   116 DKLTILRMAVSHMKSMRGTGNTST-DGA-YKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYV 178

  Fly   133 SDSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLC 197
            ||||:.|||..|::..|.:.|:.:||.|:.|::||||:.|.....|::|.||. .||.:..||..
Zfish   179 SDSVTPVLNHPQSEWFGSTLFEQVHPDDVDKLREQLSTSENSMTGRILDLKTG-TVKKEGQQSSM 242

  Fly   198 RLCPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTG--------HKYRVIQCTG 254
            |:|.|:||||.|||:..:|..:.|       |.:|.|:.|| |...|        .:|.|:.|||
Zfish   243 RMCMGSRRSFICRMRCGSAPLDHI-------SLNRLSSMRK-RYRNGLGPSKEGEAQYSVVHCTG 299

  Fly   255 YLKSWTP----IKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRH 315
            |:|:|.|    |.|||.:|..    |:..|||||||:  .|.:|  |.|:|.:.......|:|||
Zfish   300 YIKAWPPAGMTIPDEDTEAGQ----TSKYCLVAIGRL--QVTSS--PVSMDMNGLSVPTEFLSRH 356

  Fly   316 SGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCK 380
            :.:|...|:|.|...|||:.||::||....|:.|.||.:.|.||.:.|:::..:|.:.:||||.|
Zfish   357 NSDGIITFVDPRCINVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRMK 421

  Fly   381 DNSYIQLQSEWRAFKNPWTSEIDYIIAKNS 410
            :..::.:::....|:||::.||:|||..|:
Zfish   422 NREWMLIRTSSFTFQNPYSDEIEYIICTNT 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 32/52 (62%)
PAS 111..212 CDD:279347 49/100 (49%)
PAS 111..173 CDD:214512 31/61 (51%)
PAS_11 311..411 CDD:291273 38/100 (38%)
PAS 311..406 CDD:238075 35/94 (37%)
arnt2XP_009301213.1 HLH 80..132 CDD:278439 32/51 (63%)
PAS 152..258 CDD:279347 53/106 (50%)
PAS 155..219 CDD:214512 31/63 (49%)
PAS_11 351..451 CDD:291273 37/99 (37%)
PAS 351..447 CDD:238075 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168098at33208
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.