DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and ahrra

DIOPT Version :10

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001030342.2 Gene:ahrra / 641291 ZFINID:ZDB-GENE-051018-1 Length:550 Species:Danio rerio


Alignment Length:164 Identity:49/164 - (29%)
Similarity:83/164 - (50%) Gaps:30/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIP-----MCFAMQRKLDKLTVLRMAVQH 79
            ::|.|....|  |.|.|   ||.|:::|..:..|:.::|     :|     |||||:|||::|.:
Zfish    20 KQKPAALMSE--KSNPS---KRHRERLNAELERLAELLPFGPDTVC-----KLDKLSVLRLSVSY 74

  Fly    80 LRGIRGSGSL----HPF------NGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSD 134
            || |:...|:    :|.      |..|...:.:.:.:|   :|::..||..||..| |.:.|.|.
Zfish    75 LR-IKSFCSVLAQENPCETQTSKNQQDTPAACVPESQL---LLESLAGFALVVSGD-GMVFYASS 134

  Fly   135 SVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQL 168
            :::..|...|.|::.|:.||.:|..|..:.:.||
Zfish   135 TIADYLGFHQTDVMHQNVFDYIHVDDRQEFRRQL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 bHLH_SF 31..92 CDD:469605 23/69 (33%)
PAS 111..173 CDD:214512 19/58 (33%)
PAS_11 311..411 CDD:464214
ahrraNP_001030342.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.