DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and ARNTL2

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001381453.1 Gene:ARNTL2 / 56938 HGNCID:18984 Length:647 Species:Homo sapiens


Alignment Length:402 Identity:198/402 - (49%)
Similarity:270/402 - (67%) Gaps:25/402 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IEDENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAV 77
            :||..:..:..|      .::.||:.|||||||||..|.|||:|||.|..|.|||||||||||||
Human   107 VEDGEHQVKMKA------FREAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAV 165

  Fly    78 QHLRGIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVLNS 142
            ||||.::  |..:.:.||:||||||.|.||:.:||:.:|||||||||:||:||:||.|||.:||.
Human   166 QHLRSLK--GLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNY 228

  Fly   143 TQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGARRSF 207
            .||.|.|||.||.|||||:.||||||||.:..|||:||||||.|.|.:::.....|:..|:||||
Human   229 DQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSGSRRSF 293

  Fly   208 FCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWTP-IKDEDQDADS 271
            |||:|   :....:|||.....:|:....|        |:..|.|||||:||.| |...:::.:|
Human   294 FCRIK---SCKISVKEEHGCLPNSKKKEHR--------KFYTIHCTGYLRSWPPNIVGMEEERNS 347

  Fly   272 DEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFIDQRATLVIGFLP 336
            .:..:|.:|||||||:.|.:    ||.: ....|::...||:|.:..|||:::|||||.::|:||
Human   348 KKDNSNFTCLVAIGRLQPYI----VPQN-SGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLP 407

  Fly   337 QEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSE 401
            ||:||||.|||||.:|...|.:.||.|:|..||:.|..|:||.||.|::.|:|:|.:|.||||.|
Human   408 QELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKE 472

  Fly   402 IDYIIAKNSVFL 413
            ::||::.|::.|
Human   473 LEYIVSVNTLVL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 37/52 (71%)
PAS 111..212 CDD:279347 63/100 (63%)
PAS 111..173 CDD:214512 43/61 (70%)
PAS_11 311..411 CDD:291273 52/99 (53%)
PAS 311..406 CDD:238075 50/94 (53%)
ARNTL2NP_001381453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..73
Interaction with PER2. /evidence=ECO:0000250|UniProtKB:Q2VPD4 57..269 101/169 (60%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q9WTL8 60..65
bHLH-PAS_ARNTL2_PASD9 119..178 CDD:381475 38/60 (63%)
Nuclear export signal 1. /evidence=ECO:0000250|UniProtKB:Q9WTL8 188..198 4/9 (44%)
PAS 203..298 CDD:238075 60/94 (64%)
PAS_11 381..483 CDD:405306 52/101 (51%)
Nuclear export signal 2. /evidence=ECO:0000250|UniProtKB:Q9WTL8 403..411 5/7 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I5024
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 421 1.000 Inparanoid score I1790
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168098at33208
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 1 1.000 - - otm40507
orthoMCL 1 0.900 - - OOG6_106197
Panther 1 1.100 - - LDO PTHR23042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.