DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and sim

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_524340.2 Gene:sim / 41612 FlyBaseID:FBgn0004666 Length:688 Species:Drosophila melanogaster


Alignment Length:398 Identity:111/398 - (27%)
Similarity:188/398 - (47%) Gaps:62/398 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQHL--RGIRGSGSLHPFNG 94
            |:......:.||:|.||...||:.::|:..|:..:|||.:|:|:...:|  |.:...|....:..
  Fly    26 KEKSKNAARTRREKENTEFCELAKLLPLPAAITSQLDKASVIRLTTSYLKMRQVFPDGLGEAWGS 90

  Fly    95 SDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVLNSTQADLLGQSWFDVLHPK 159
            |.......:.:||...:||..:||:|||..| |:|:|:|::.|..|..:|.:|.|.|.|:.:|..
  Fly    91 SPAMQRGATIKELGSHLLQTLDGFIFVVAPD-GKIMYISETASVHLGLSQVELTGNSIFEYIHNY 154

  Fly   160 DIGKVKEQLS---SLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGA------------RRSFFC 209
            |..::...||   .:.|.|.     |:|..|:.:  |..:..  |.|            .::||.
  Fly   155 DQDEMNAILSLHPHINQHPL-----AQTHTPIGS--PNGVQH--PSAYDHDRGSHTIEIEKTFFL 210

  Fly   210 RMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWT-PIKDEDQDADSDE 273
            |||...|                   ||.:.|||. .::||.|:||||:.. |.:.:.|.:    
  Fly   211 RMKCVLA-------------------KRNAGLTTS-GFKVIHCSGYLKARIYPDRGDGQGS---- 251

  Fly   274 QTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFIDQRATLVIGFLPQE 338
            ...||. |||:|.        ::|:|......:...:|:.|...:.|.:|.|.|.:.:.|:.||:
  Fly   252 LIQNLG-LVAVGH--------SLPSSAITEIKLHQNMFMFRAKLDMKLIFFDARVSQLTGYEPQD 307

  Fly   339 ILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEID 403
            ::..:.|:|.|..||.|:..||:::: ...:|||:.|||..|...::.:||......|..:|...
  Fly   308 LIEKTLYQYIHAADIMAMRCSHQILL-YKGQVTTKYYRFLTKGGGWVWVQSYATLVHNSRSSREV 371

  Fly   404 YIIAKNSV 411
            :|::.|.|
  Fly   372 FIVSVNYV 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 17/53 (32%)
PAS 111..212 CDD:279347 34/115 (30%)
PAS 111..173 CDD:214512 23/64 (36%)
PAS_11 311..411 CDD:291273 30/99 (30%)
PAS 311..406 CDD:238075 28/94 (30%)
simNP_524340.2 HLH 26..78 CDD:238036 16/51 (31%)
PAS 102..215 CDD:279347 38/122 (31%)
PAS 102..163 CDD:214512 23/61 (38%)
PAS 278..376 CDD:238075 29/98 (30%)
PAS_3 291..377 CDD:285623 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.