DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and ARNT

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001659.1 Gene:ARNT / 405 HGNCID:700 Length:789 Species:Homo sapiens


Alignment Length:410 Identity:168/410 - (40%)
Similarity:255/410 - (62%) Gaps:35/410 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEEKSARTSDEN--------RKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRM 75
            |:|:.||:.||.        .::||||||:|||:||..||.|||.|:|.|.|:.||.||||:|||
Human    70 DKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRM 134

  Fly    76 AVQHLRGIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVL 140
            ||.|::.:||:|:... :|| |:||||:|||||.:||:|::||||:|.|:.||::||||||:.||
Human   135 AVSHMKSLRGTGNTST-DGS-YKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVL 197

  Fly   141 NSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGARR 205
            |..|::..|.:.:|.:||.|:.|::||||:.|.....|::|.||. .||.:..||..|:|.|:||
Human   198 NQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTG-TVKKEGQQSSMRMCMGSRR 261

  Fly   206 SFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGH------KYRVIQCTGYLKSWTP--- 261
            ||.|||:..::|.:.:      |.:..|..:.:.|...|.      .:.|:.||||:|:|.|   
Human   262 SFICRMRCGSSSVDPV------SVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGV 320

  Fly   262 -IKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFID 325
             :.|:|.:|....:    .|||||||:  .|.:|  |...|.....:...|||||:.||.|.|:|
Human   321 SLPDDDPEAGQGSK----FCLVAIGRL--QVTSS--PNCTDMSNVCQPTEFISRHNIEGIFTFVD 377

  Fly   326 QRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSE 390
            .|....:|:.|||:||.:..|:.|.||...|.:|.:.|:::..:|.:.::|||.|:..::.:::.
Human   378 HRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTS 442

  Fly   391 WRAFKNPWTSEIDYIIAKNS 410
            ...|:||::.||:|||..|:
Human   443 SFTFQNPYSDEIEYIICTNT 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 32/52 (62%)
PAS 111..212 CDD:279347 49/100 (49%)
PAS 111..173 CDD:214512 31/61 (51%)
PAS_11 311..411 CDD:291273 38/100 (38%)
PAS 311..406 CDD:238075 35/94 (37%)
ARNTNP_001659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97 9/26 (35%)
DNA-binding. /evidence=ECO:0000269|PubMed:28396409 88..128 22/39 (56%)
HLH 91..143 CDD:278439 32/51 (63%)
Required for heterodimer formation with EPAS1. /evidence=ECO:0000250|UniProtKB:P53762 112..264 79/154 (51%)
Required for heterodimer formation with HIF1A. /evidence=ECO:0000250|UniProtKB:P53762 112..168 33/57 (58%)
PAS 163..269 CDD:279347 53/106 (50%)
PAS 166..230 CDD:214512 31/63 (49%)
Mediates the transcription activity and dimerization of the AHR:ARNT complex. /evidence=ECO:0000250|UniProtKB:P53762 167..171 2/3 (67%)
PAS_11 362..462 CDD:291273 37/99 (37%)
PAS 362..458 CDD:238075 35/95 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 465..492
Med3 <523..>734 CDD:288447
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 672..789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168098at33208
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.