DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and Clk

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001014576.1 Gene:Clk / 38872 FlyBaseID:FBgn0023076 Length:1027 Species:Drosophila melanogaster


Alignment Length:413 Identity:106/413 - (25%)
Similarity:196/413 - (47%) Gaps:64/413 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQH 79
            |:..|::...::....:.:|.|  ||:|||:.|:.:|:||::|.   ...||:||.|||:..:..
  Fly     2 DDESDDKDDTKSFLCRKSRNLS--EKKRRDQFNSLVNDLSALIS---TSSRKMDKSTVLKSTIAF 61

  Fly    80 LRG-IRGSGSLHPFN-GSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVLNS 142
            |:. ...:.....|. ..|::|:|||:.|...::|::.:||:.|.. ..|.|.|.|:|::|.|..
  Fly    62 LKNHNEATDRSKVFEIQQDWKPAFLSNDEYTHLMLESLDGFMMVFS-SMGSIFYASESITSQLGY 125

  Fly   143 TQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGARRSF 207
            ...||...:.:|:.:..|    .|.|.::...|      ...:.|.:||:..|       .:.:|
  Fly   126 LPQDLYNMTIYDLAYEMD----HEALLNIFMNP------TPVIEPRQTDISSS-------NQITF 173

  Fly   208 FCRMKL----RTASN--------NQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWT 260
            :..::.    :..:|        ...:.:::||:.|.|.....|........|:.|         
  Fly   174 YTHLRRGGMEKVDANAYELVKFVGYFRNDTNTSTGSSSEVSNGSNGQPAVLPRIFQ--------- 229

  Fly   261 PIKDEDQDADSDEQTTNLSCLVAIGRI--PPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLF 323
                ::.:|:.|::..    .|..||:  |..:|..::.....|.       |.|:||.|.||||
  Fly   230 ----QNPNAEVDKKLV----FVGTGRVQNPQLIREMSIIDPTSNE-------FTSKHSMEWKFLF 279

  Fly   324 IDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQ 388
            :|.||..:||::|.|:||||.|:|:|.:|:.:::..|:.:.|..|..:. .|||..|...:|.||
  Fly   280 LDHRAPPIIGYMPFEVLGTSGYDYYHFDDLDSIVACHEELRQTGEGKSC-YYRFLTKGQQWIWLQ 343

  Fly   389 SEWRAFKNPWTSEIDYIIAKNSV 411
            :::....:.:.|:.||::..:.|
  Fly   344 TDYYVSYHQFNSKPDYVVCTHKV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 20/53 (38%)
PAS 111..212 CDD:279347 23/100 (23%)
PAS 111..173 CDD:214512 17/61 (28%)
PAS_11 311..411 CDD:291273 37/99 (37%)
PAS 311..406 CDD:238075 37/94 (39%)
ClkNP_001014576.1 HLH 16..68 CDD:238036 20/56 (36%)
PAS 93..153 CDD:214512 17/64 (27%)
PAS 264..366 CDD:238075 38/109 (35%)
PAS_11 265..368 CDD:291273 39/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.