DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and clockb

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_840080.2 Gene:clockb / 352927 ZFINID:ZDB-GENE-030408-2 Length:820 Species:Danio rerio


Alignment Length:421 Identity:120/421 - (28%)
Similarity:191/421 - (45%) Gaps:91/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MEEIEDENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLR 74
            |||      ||:..|:....|:.      ||:|||:.|..|.||.:|:|   ...||:||.|:|:
Zfish    16 MEE------DEKDKAKRVSRNKS------EKKRRDQFNVLIKELGTMLP---GNTRKMDKSTILQ 65

  Fly    75 MAVQHLRGIRGSGSLHPFNG--SDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVS 137
            .::.:||..:.:.:....:.  .|::|.|||::|...::|:|.:||..|:..| |.|:|:|:||:
Zfish    66 KSIDYLRKNKENAAQSESSDIKQDWKPPFLSNEEFSQLMLEALDGFFLVMLTD-GYIIYISESVT 129

  Fly   138 SVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSS---LEQCPRERLIDAKTMLPVKTDVPQSLCRL 199
            |:|....:||:.|:..:.|...|.|:|.:.|||   :|....:.|.....|              
Zfish   130 SLLEHLPSDLMDQNLLNFLPVVDHGEVYKALSSQPDIENLNSDYLKSKNQM-------------- 180

  Fly   200 CPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWT--PI 262
                  .|.|.|                   .|.|...|....    |..::..|..||..  |.
Zfish   181 ------EFCCHM-------------------LRGSVDPKKPPV----YEYVKFIGNFKSLVNMPQ 216

  Fly   263 KDED----------QDADSDEQTTNLSCLVAIGRI--PPNVRNSTVPASLDNHPNIRHVLFISRH 315
            |..:          |.|..|:     .|.:|..|:  |..::.    ..:...||..   |.|||
Zfish   217 KTRNGLEGILQHSLQPAFDDQ-----LCFIATVRLAKPQFIKE----MCMVEEPNEE---FTSRH 269

  Fly   316 SGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCK 380
            |.|.|||.:|.||..:||::|.|:||||.|:|:|.:|:.:|.:.|:.:||. .|..:..|||..|
Zfish   270 SLEWKFLLLDHRAPPIIGYMPFEVLGTSGYDYYHVDDLHSLAKCHEHLMQF-GKGKSCYYRFLTK 333

  Fly   381 DNSYIQLQSEWRAFKNPWTSEIDYIIAKNSV 411
            ...:|.||:.:....:.|.|..::|:..::|
Zfish   334 GQQWIWLQTNYYITYHQWNSRPEFIVCTHTV 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 19/52 (37%)
PAS 111..212 CDD:279347 29/103 (28%)
PAS 111..173 CDD:214512 24/64 (38%)
PAS_11 311..411 CDD:291273 39/99 (39%)
PAS 311..406 CDD:238075 38/94 (40%)
clockbNP_840080.2 HLH 22..76 CDD:238036 21/62 (34%)
PAS 99..160 CDD:214512 22/61 (36%)
PAS_11 263..366 CDD:291273 40/106 (38%)
PAS 264..362 CDD:238075 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.