DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and Npas2

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_038939510.1 Gene:Npas2 / 316351 RGDID:1309681 Length:855 Species:Rattus norvegicus


Alignment Length:434 Identity:131/434 - (30%)
Similarity:195/434 - (44%) Gaps:83/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQH 79
            ||  ||:..|:.:..|:.      ||:|||:.|..|.|||||:|   ...|||||.|||...:  
  Rat     2 DE--DEKDRAKRASRNKS------EKKRRDQFNVLIKELSSMLP---GNTRKLDKTTVLEKVI-- 53

  Fly    80 LRGIRGSGSLHPFN-----------GSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVS 133
                   |.|...|           ..|::|||||::|...::|:|.:||:.||..| |.|:|||
  Rat    54 -------GFLQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFVIVVTTD-GSIIYVS 110

  Fly   134 DSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPV---------- 188
            ||::.:|....                 |..:|.:..|.:....||.....:.||          
  Rat   111 DSITPLLGHLP-----------------GTEEESMKGLHRSRTLRLCLRSEVHPVERASFSLYFL 158

  Fly   189 -KTDV-PQSLCRLCPGARRSFFCRM----KLRTASNNQ--IKEESDTS---SSSRSSTKRKSRLT 242
             ::|| .|:|....|....|...::    .|.|.|.:.  :|.::|..   ...|.|...|...|
  Rat   159 LQSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEFLKSDNDLEFYCHLLRGSLNPKEFPT 223

  Fly   243 TGHKYRVIQCTGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGR---IPPNVRNSTVPASLDNHP 304
                |..|:..|..:|:..:  .....:..:.|.:..|.|.:|:   ....||.:| |..|....
  Rat   224 ----YEYIKFVGNFRSYNNV--PSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLAT-PQFLKEMC 281

  Fly   305 NIRHVL--FISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVP 367
            .....|  |.||||.|.||||:|.||..:||:||.|:||||.|:|:|.:|:..|...|:.:||. 
  Rat   282 VADEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCHQHLMQF- 345

  Fly   368 EKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSV 411
            .|..:..|||..|...:|.||:.:....:.|.|:.::|:..:||
  Rat   346 GKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 21/52 (40%)
PAS 111..212 CDD:279347 28/116 (24%)
PAS 111..173 CDD:214512 18/61 (30%)
PAS_11 311..411 CDD:291273 41/99 (41%)
PAS 311..406 CDD:238075 40/94 (43%)
Npas2XP_038939510.1 bHLH-PAS_NPAS2_PASD4 1..77 CDD:381580 31/94 (33%)
PAS 84..234 CDD:395786 41/171 (24%)
PAS_11 288..391 CDD:405306 43/103 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.