DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and Ncoa1

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_017449617.1 Gene:Ncoa1 / 313929 RGDID:1309046 Length:1443 Species:Rattus norvegicus


Alignment Length:409 Identity:91/409 - (22%)
Similarity:159/409 - (38%) Gaps:108/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEEKSARTSDENRKQNH------SEIEKRRRDKMNTYINELSSMIPMCF----AMQRKLDKLTVL 73
            |........|.::::..      |..|||||::.|.|:.||:.::....    ::..|.||..:|
  Rat     6 DSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKIL 70

  Fly    74 RMAVQHLRGIRGSGSLHPFNGSDYRPSFLSD--------QELKMIILQASEGFLFVVGCDRGRIL 130
            :..|..::.::...........|.:.|.:|.        :.|..::|:|.:||.|||.|: |||:
  Rat    71 KKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCE-GRIV 134

  Fly   131 YVSDSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQS 195
            :||::|:|.|...|.:|:..|.:.:||..|..:.                       ||..:|:|
  Rat   135 FVSENVTSYLGYNQEELMNTSVYSILHVGDHAEF-----------------------VKNLLPKS 176

  Fly   196 LCRLCP----GARR---SFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQC- 252
            |....|    ..||   :|.|||.:..      .:|..|.:....           .:|.|:|| 
  Rat   177 LVNGVPWPQEATRRNSHTFNCRMLIHP------PDEPGTENQEAC-----------QRYEVMQCF 224

  Fly   253 -TGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHV-LFISRH 315
             ....||   |:::.:|..        |||:.|.|            .|...|.|..| .|:::.
  Rat   225 TVSQPKS---IQEDGEDFQ--------SCLICIAR------------RLPRPPAITGVESFMTKQ 266

  Fly   316 SGEGKFLFIDQ---RATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQ---- 373
            ...||.:.||.   ||....|:  ::::....|.:|..:.     .......|:.::|.|:    
  Rat   267 DTTGKIISIDTSSLRAAGRTGW--EDLVRKCIYAFFQPQG-----REPSYARQLFQEVMTRGTAS 324

  Fly   374 --VYRFRCKDNSYIQLQSE 390
              .|||...|.:.:...::
  Rat   325 SPSYRFILNDGTMLSAHTK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 15/62 (24%)
PAS 111..212 CDD:279347 33/107 (31%)
PAS 111..173 CDD:214512 22/61 (36%)
PAS_11 311..411 CDD:291273 17/89 (19%)
PAS 311..406 CDD:238075 17/89 (19%)
Ncoa1XP_017449617.1 bHLH-PAS_NCoA1_SRC1 27..87 CDD:381518 15/59 (25%)
PAS 120..213 CDD:238075 34/122 (28%)
PAS_11 260..370 CDD:405306 17/91 (19%)
NCOA_u2 469..591 CDD:406952
SRC-1 633..709 CDD:400955
DUF4927 744..821 CDD:406644
Nuc_rec_co-act 927..972 CDD:400942
Med15 995..>1362 CDD:312941
DUF1518 1152..1208 CDD:400033
DUF1518 1215..1270 CDD:400033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.