DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and clocka

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_571032.2 Gene:clocka / 30140 ZFINID:ZDB-GENE-990630-14 Length:892 Species:Danio rerio


Alignment Length:425 Identity:119/425 - (28%)
Similarity:194/425 - (45%) Gaps:98/425 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MEEIEDENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLR 74
            |||      ||:..|:....||.      ||:|||:.|..|.||.:|:|   ...||:||.|:|:
Zfish    17 MEE------DEKDKAKRVSRNRS------EKKRRDQFNVLIKELGTMLP---GNTRKMDKSTILQ 66

  Fly    75 MAVQHLRGIR------GSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVS 133
            .::..||..:      .|..:.    .|::|.|||::|...::|:|.:||...:..| |.|:|||
Zfish    67 KSIDFLRKHKEIAAQSESSEIR----QDWKPPFLSNEEFTQLMLEALDGFFLAIMTD-GNIIYVS 126

  Fly   134 DSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLP--VKTDVPQSL 196
            :||:|:|....:||:.|:..:.|...:..:|.:.||:       .:::.:|:.|  :||......
Zfish   127 ESVTSLLEHLPSDLVDQNLLNFLPLGEHSEVYKALST-------HMLEGETLTPDYLKTKNQLEF 184

  Fly   197 CRLCPGARRSFFCRMKLRTASNNQ------------IKEESDTSSSSRSSTKRKSRLTTGHKYRV 249
            |           |.|...|....:            .|..:...:|:|:..:...:.:..|.:  
Zfish   185 C-----------CHMLRGTIDPKEPPVYEYVKFIGNFKSLNTVPNSTRNGFEGVIQRSLRHAF-- 236

  Fly   250 IQCTGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGRI--PPNVRN-STVPASLDNHPNIRHVLF 311
                           ||:           .|.:|..|:  |..::. .||     ..||..   |
Zfish   237 ---------------EDR-----------VCFIATVRLAKPQFIKEMCTV-----EEPNEE---F 267

  Fly   312 ISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYR 376
            .||||.|.||||:|.||..:||:||.|:||||.|:|:|.:|:..|.:.|:.:||. .|..:..||
Zfish   268 TSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLETLAKCHEHLMQY-GKGKSCYYR 331

  Fly   377 FRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSV 411
            |..|...:|.||:.:....:.|.|..::|:..::|
Zfish   332 FLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 20/52 (38%)
PAS 111..212 CDD:279347 27/102 (26%)
PAS 111..173 CDD:214512 21/61 (34%)
PAS_11 311..411 CDD:291273 41/99 (41%)
PAS 311..406 CDD:238075 40/94 (43%)
clockaNP_571032.2 HLH 23..77 CDD:238036 22/62 (35%)
PAS 100..>169 CDD:279347 22/76 (29%)
PAS 109..207 CDD:238075 27/116 (23%)
PAS_11 265..368 CDD:291273 42/106 (40%)
PAS 266..364 CDD:238075 41/101 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.