DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and Ncoa3

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_032705.2 Gene:Ncoa3 / 17979 MGIID:1276535 Length:1403 Species:Mus musculus


Alignment Length:379 Identity:95/379 - (25%)
Similarity:162/379 - (42%) Gaps:73/379 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKRRRDKMNTYINELSSMIPMCFA----MQRKLDKLTVLRMAVQHLRGIRGSG-------SLHPF 92
            ||.||::.:.||.||:.:|....:    ...|.||..:|:..|:.:|.|:..|       .:...
Mouse    35 EKWRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKA 99

  Fly    93 NGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVLNSTQADLLGQSWFDVLH 157
            :.|......:....|..::|||.:||||||..| |.|::||::|:..|...|.||:..|.:.:||
Mouse   100 DVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRD-GNIVFVSENVTQYLQYKQEDLVNTSVYSILH 163

  Fly   158 PKDIGKVKEQLSSLEQCPRERLIDAKTMLPVK-TDVPQSLCRLCPGARRSFFCRMKLRTASNNQI 221
            .:|      :...|:..|:      .|:..|. |:..|.      ....:|.|||.::|   :.|
Mouse   164 EQD------RKDFLKHLPK------STVNGVSWTNENQR------QKSHTFNCRMLMKT---HDI 207

  Fly   222 KEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGR 286
            .|:.:.|..:|            .:|..:||.. |.....:.:|.:|..        .|::.:.|
Mouse   208 LEDVNASPETR------------QRYETMQCFA-LSQPRAMLEEGEDLQ--------CCMICVAR 251

  Fly   287 IPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFIDQ---RATLVIGFLPQEILGTSFYEYF 348
                    .|.|...:.|.    .||:||...||.:.||.   |:::..||  ::|:......:|
Mouse   252 --------RVTAPFPSSPE----SFITRHDLSGKVVNIDTNSLRSSMRPGF--EDIIRRCIQRFF 302

  Fly   349 H-NEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSE 401
            . |:..:...:.|.....|.....|.||||...|.:.:..|::.:.|:||.|::
Mouse   303 SLNDGQSWSQKRHYQEAYVHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTND 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 15/48 (31%)
PAS 111..212 CDD:279347 32/101 (32%)
PAS 111..173 CDD:214512 24/61 (39%)
PAS_11 311..411 CDD:291273 27/95 (28%)
PAS 311..406 CDD:238075 27/95 (28%)
Ncoa3NP_032705.2 bHLH_SF 33..102 CDD:381792 17/66 (26%)
PAS 117..172 CDD:214512 23/61 (38%)
PAS_11 262..372 CDD:373151 27/101 (27%)
NCOA_u2 451..564 CDD:374708
SRC-1 608..696 CDD:370145
DUF4927 714..801 CDD:374467
Nuc_rec_co-act 1056..1103 CDD:312376
Med15 1094..>1398 CDD:312941
DUF1518 1270..1326 CDD:369380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.