DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and Ncoa2

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_017174718.1 Gene:Ncoa2 / 17978 MGIID:1276533 Length:1517 Species:Mus musculus


Alignment Length:433 Identity:105/433 - (24%)
Similarity:181/433 - (41%) Gaps:110/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ENYDEEKSARTSDENRKQNHSEI--------EKRRRDKMNTYINELSSMIPMCFA-------MQR 65
            ||..:...|.|  ..||:...::        |||.|::.|.||.||:.:|   ||       ...
Mouse     6 ENTSDPSRAET--RKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELI---FANFNDIDNFNF 65

  Fly    66 KLDKLTVLRMAVQHLRGIRGSGSLHPFNGSDYRPSFLS-------DQE-LKMIILQASEGFLFVV 122
            |.||..:|:..|:.:|.|:........|..:.:.|.:|       |:: |..::|:|.:||.|||
Mouse    66 KPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVV 130

  Fly   123 GCDRGRILYVSDSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLP 187
            ..: |.:::||::|:..|...|.:|:.:|.:.:||   :|...|.:.:|                
Mouse   131 NLE-GSVVFVSENVTQYLRYNQEELMNKSVYSILH---VGDHTEFVKNL---------------- 175

  Fly   188 VKTDVPQSLCRLCPGA------RRS---FFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTT 243
                :|:|:..  .|:      |||   |.|||.::...:::  ||...|..:.           
Mouse   176 ----LPKSMVN--GGSWSGEPPRRSSHTFNCRMLVKPLPDSE--EEGHDSQEAH----------- 221

  Fly   244 GHKYRVIQC--TGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNI 306
             .||..:||  ....||   ||:|.:|..        |||:.:.|..|.....|:|:|..     
Mouse   222 -QKYEAMQCFAVSQPKS---IKEEGEDLQ--------SCLICVARRVPMKERPTLPSSES----- 269

  Fly   307 RHVLFISRHSGEGKFLFID---QRATLVIGFLPQEILGTSFYEYFH----NEDIAALMESHKMVM 364
                |.:|...:||...:|   .||.:..|:   |.|.....:.||    .|.::.....|..|:
Mouse   270 ----FTTRQDLQGKITSLDTSTMRAAMKPGW---EDLVRRCIQKFHTQHEGESLSYAKRHHHEVL 327

  Fly   365 QVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIA 407
            : .....:|:|||...|.:.:..|::.:..::..|:|...:|:
Mouse   328 R-QGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVIS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 20/67 (30%)
PAS 111..212 CDD:279347 29/109 (27%)
PAS 111..173 CDD:214512 20/61 (33%)
PAS_11 311..411 CDD:291273 24/104 (23%)
PAS 311..406 CDD:238075 23/101 (23%)
Ncoa2XP_017174718.1 bHLH-PAS_NCoA2_SRC2 28..91 CDD:381520 19/65 (29%)
PAS 118..175 CDD:214512 19/60 (32%)
PAS_11 268..378 CDD:405306 24/115 (21%)
NCOA_u2 463..587 CDD:406952
SRC-1 636..709 CDD:400955
DUF4927 731..816 CDD:406644
Nuc_rec_co-act 1076..1120 CDD:400942
Med15 <1130..>1408 CDD:312941
DUF1518 1284..1341 CDD:400033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.