DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and aha-1

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001251327.1 Gene:aha-1 / 172889 WormBaseID:WBGene00000095 Length:453 Species:Caenorhabditis elegans


Alignment Length:419 Identity:144/419 - (34%)
Similarity:219/419 - (52%) Gaps:68/419 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIEDENYDEEKSARTSD---ENR----KQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDK 69
            |.||......|.||..|   ||:    ::||||||:|||:||..|||||:.|:|.|.::.||.||
 Worm    19 EDEDMGMPSGKYARMEDEMGENKERFARENHSEIERRRRNKMTHYINELAEMVPQCASLGRKPDK 83

  Fly    70 LTVLRMAVQHLRGIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSD 134
            ||:|||||.|::||||..:.   :.:.|:||||:|||||.:||:|:.||||||.|..|::|||:|
 Worm    84 LTILRMAVSHMKGIRGHTAQ---DETSYKPSFLTDQELKHLILEAANGFLFVVCCQTGKVLYVAD 145

  Fly   135 SVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRE----RLIDAKTMLPVKTDVPQS 195
            |::.|||..|.|.|.::..:::||.|..|:::||     |..|    :::|.|:. .||.:...:
 Worm   146 SITPVLNLKQEDWLQRNLNELIHPDDQDKIRDQL-----CGSEVSVNKVLDLKSG-SVKREGAST 204

  Fly   196 LCRLCPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWT 260
              |:....||.|.|||::           .......|...:|......|..|.|:.||||:|:..
 Worm   205 --RVHMSCRRGFICRMRV-----------GALEPLHRLRNRRPLFQHAGQNYVVMHCTGYIKNAP 256

  Fly   261 PIKDEDQDADSDEQTTNL---SCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFL 322
            |            |..|.   ||||||.|:    :.:::|...|  |...: .|..|.|.:||..
 Worm   257 P------------QGINAPASSCLVAIARL----QVASMPVCAD--PTSTN-QFSVRVSEDGKMT 302

  Fly   323 FIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMV-----MQVPEKVTTQVYRFRCKDN 382
            |||.|.:.:||....:::|..::...|..|...|.:|...:     |::..:|.|......|..:
 Worm   303 FIDARVSDLIGLSSDQLIGRYWWNLAHPADEKTLQDSFVALLSDQPMRINIRVRTSTDYIPCTVS 367

  Fly   383 SYIQLQSEWRAFKNPWTSEIDYIIAKNSV 411
            :|        .|.||::.:.:|::|.:.:
 Worm   368 AY--------KFMNPYSEQFEYVVATHQI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 32/56 (57%)
PAS 111..212 CDD:279347 40/104 (38%)
PAS 111..173 CDD:214512 28/61 (46%)
PAS_11 311..411 CDD:291273 26/104 (25%)
PAS 311..406 CDD:238075 25/99 (25%)
aha-1NP_001251327.1 HLH 46..98 CDD:278439 32/51 (63%)
PAS 117..219 CDD:279347 43/109 (39%)
PAS 120..179 CDD:214512 26/58 (45%)
PAS 288..388 CDD:238075 26/108 (24%)
PAS_11 289..393 CDD:291273 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I6073
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168098at33208
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.