DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and Arnt

DIOPT Version :9

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001032826.1 Gene:Arnt / 11863 MGIID:88071 Length:791 Species:Mus musculus


Alignment Length:413 Identity:173/413 - (41%)
Similarity:255/413 - (61%) Gaps:41/413 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEEKSARTSDEN--------RKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRM 75
            |:|:.||:.||.        .::||||||:|||:||..||.|||.|:|.|.|:.||.||||:|||
Mouse    70 DKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRM 134

  Fly    76 AVQHLRGIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVL 140
            ||.|::.:||:|:... :|| |:||||:|||||.:||:|::||||:|.|:.||::||||||:.||
Mouse   135 AVSHMKSLRGTGNTST-DGS-YKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVL 197

  Fly   141 NSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGARR 205
            |..|::..|.:.:|.:||.|:.|::||||:.|.....|::|.||. .||.:..||..|:|.|:||
Mouse   198 NQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTG-TVKKEGQQSSMRMCMGSRR 261

  Fly   206 SFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTG---------HKYRVIQCTGYLKSWTP 261
            ||.|||:..|:|       .|..|.:|.|..| :|...|         | :.|:.||||:|:|.|
Mouse   262 SFICRMRCGTSS-------VDPVSMNRLSFLR-NRCRNGLGSVKEGEPH-FVVVHCTGYIKAWPP 317

  Fly   262 ----IKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFL 322
                :.|:|.:|....:    .|||||||:  .|.:|  |...|.....:...|||||:.||.|.
Mouse   318 AGVSLPDDDPEAGQGSK----FCLVAIGRL--QVTSS--PNCTDMSNICQPTEFISRHNIEGIFT 374

  Fly   323 FIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQL 387
            |:|.|....:|:.|||:||.:..|:.|.||...|.:|.:.|:::..:|.:.::|||.|...::.:
Mouse   375 FVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWLWM 439

  Fly   388 QSEWRAFKNPWTSEIDYIIAKNS 410
            ::....|:||::.||:|||..|:
Mouse   440 RTSSFTFQNPYSDEIEYIICTNT 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 HLH 31..84 CDD:278439 32/52 (62%)
PAS 111..212 CDD:279347 49/100 (49%)
PAS 111..173 CDD:214512 31/61 (51%)
PAS_11 311..411 CDD:291273 38/100 (38%)
PAS 311..406 CDD:238075 35/94 (37%)
ArntNP_001032826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..97 7/23 (30%)
DNA-binding. /evidence=ECO:0000269|PubMed:26245371, ECO:0000269|PubMed:28602820 88..128 22/39 (56%)
HLH 91..143 CDD:278439 32/51 (63%)
Required for heterodimer formation with EPAS1. /evidence=ECO:0000269|PubMed:26245371 112..264 79/154 (51%)
Required for heterodimer formation with HIF1A. /evidence=ECO:0000269|PubMed:26245371 112..168 33/57 (58%)
PAS 163..269 CDD:279347 53/106 (50%)
PAS 166..230 CDD:214512 31/63 (49%)
Mediates the transcription activity and dimerization of the AHR:ARNT complex. /evidence=ECO:0000269|PubMed:24001774 167..171 2/3 (67%)
PAS_11 362..462 CDD:291273 37/99 (37%)
PAS 362..458 CDD:238075 35/95 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 465..508
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 530..554
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 631..667
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..715
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 730..791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.