DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyc and Ahr

DIOPT Version :10

Sequence 1:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_038492.1 Gene:Ahr / 11622 MGIID:105043 Length:805 Species:Mus musculus


Alignment Length:407 Identity:97/407 - (23%)
Similarity:169/407 - (41%) Gaps:87/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQHLRG------IRGSG 87
            |..|.|.|   ||.||::||.::.|:|::|....:..|||||:|||::|.:||.      ...|.
Mouse    28 EGIKSNPS---KRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKST 89

  Fly    88 SLHPFNGSDYRPSFLSD-QELK--MIILQASEGFLFVVGCDRGRILYVSDSVSSVLNSTQADLLG 149
            ......|.|...:.:.| |:|:  ..:|||..||:.||..| ..:.|.|.::...|...|:|::.
Mouse    90 PADRNGGQDQCRAQIRDWQDLQEGEFLLQALNGFVLVVTAD-ALVFYASSTIQDYLGFQQSDVIH 153

  Fly   150 QSWFDVLHPKDIGKVKEQL---------SSLEQC---PRERLIDAKTMLPVKTDVPQSLCRLCPG 202
            ||.::::|.:|..:.:.||         ..:::.   |:..:......||     |::...:   
Mouse   154 QSVYELIHTEDRAEFQRQLHWALNPDSAQGVDEAHGPPQAAVYYTPDQLP-----PENASFM--- 210

  Fly   203 ARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCTGYLKSWTPIKDEDQ 267
             .|.|.||::...          |.||.                :..:...|.||.......:.:
Mouse   211 -ERCFRCRLRCLL----------DNSSG----------------FLAMNFQGRLKYLHGQNKKGK 248

  Fly   268 DADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNI-----RHVLFISRHSGEGKFLFIDQR 327
            |.               ..:||.:....:...| ..|:|     ::.:|.::|..:...:..|.:
Mouse   249 DG---------------ALLPPQLALFAIATPL-QPPSILEIRTKNFIFRTKHKLDFTPIGCDAK 297

  Fly   328 ATLVIGFLPQEILGT-SFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEW 391
            ..|::|:...|:... |.|::.|..||....|||..:::..|...| |:|...|.:.:..:||..
Mouse   298 GQLILGYTEVELCTRGSGYQFIHAADILHCAESHIRMIKTGESGMT-VFRLLAKHSRWRWVQSNA 361

  Fly   392 R-AFKNPWTSEIDYIIA 407
            | .::|   ...|||||
Mouse   362 RLIYRN---GRPDYIIA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cycNP_524168.2 bHLH_SF 31..92 CDD:469605 24/66 (36%)
PAS 111..173 CDD:214512 19/70 (27%)
PAS_11 311..411 CDD:464214 28/99 (28%)
AhrNP_038492.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 5/12 (42%)
Nuclear localization signal 1. /evidence=ECO:0000250|UniProtKB:P35869 12..15
bHLH-PAS_AhR 27..87 CDD:381442 24/61 (39%)
Nuclear localization signal 2. /evidence=ECO:0000250|UniProtKB:P35869 36..41 3/4 (75%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:P35869 37..65 10/27 (37%)
Required for maintaining the overall integrity of the AHR:ARNT heterodimer and its transcriptional activity. /evidence=ECO:0000250|UniProtKB:P35869 49..81 14/31 (45%)
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:P35869 63..71 6/7 (86%)
PAS 111..>177 CDD:395786 19/66 (29%)
Required for maintaining the overall integrity of the AHR:ARNT heterodimer and its transcriptional activity. /evidence=ECO:0000250|UniProtKB:P30561 116..124 4/7 (57%)
Required for maintaining the overall integrity of the AHR:ARNT heterodimer and its transcriptional activity. /evidence=ECO:0000250|UniProtKB:P30561 260..262 0/1 (0%)
PAS_3 291..376 CDD:430001 26/89 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..449
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.