DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and AT1G66540

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_176827.2 Gene:AT1G66540 / 842972 AraportID:AT1G66540 Length:386 Species:Arabidopsis thaliana


Alignment Length:383 Identity:89/383 - (23%)
Similarity:159/383 - (41%) Gaps:47/383 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EHRHFAMKQMRNVGYGRSQMEHHIEL-------EAEELLGQLERT-----EEQPIEPVTWLAQSV 180
            ||    .:.:|.:|.......|.:..       |...|:.:|.|:     |...:|..:.|:...
plant     8 EH----WRNLRRIGAVEIFSNHRLNSFYTIRRDEIRRLIARLSRSPNASLEFAKVEMNSMLSNLA 68

  Fly   181 LNVLWCLIAGKRI---ARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGY-NLI 241
            .|.:..::.||..   ..::|...:|:..|:......|. .|......|.||.:    |.: ..:
plant    69 FNNIIRMVTGKCYYGDGAEDDPEAKRVRQLIAEAMSCFG-AGHAADHLPMLRWI----TDFERRV 128

  Fly   242 QQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDF 306
            :::...|..||...::|.|  :||:..  |:.:|...|....     .:...:.:..:..|:|..
plant   129 KKIAARLDEFFQRLVDEKR--VAKEKK--ENTMIDHLLSLQV-----SQPEYYTDHTIKGTMLSL 184

  Fly   307 FIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVA---AASTDAFPHLSRREAFDYMDAFIM 368
            .:||:.|::.|:..||..|...|:|.:|:..::...:.   .......|:|      .|:...:.
plant   185 ILAGTDTSAVTLEWALSSLLNNPEVLKKVRDEIDNQIGLDRLLEESDIPNL------PYLQNIVS 243

  Fly   369 EVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGK 433
            |..|.:...|:..|..:....|:||||:|....:|:::.::|.|...|.||..|:|||| :..|:
plant   244 ETLRLYPAGPLLVPHISSEDCKVGGYDMPCGTMLLVNVWAIHRDPRLWDDPASFKPERF-EKEGE 307

  Fly   434 CFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGESPSMVLLPGITL 491
            ..|   .:.||:|||.|.|..|||..:...|..::|.|.......|...|....|:|:
plant   308 THK---LLTFGLGRRACPGSGLARRLVSLSLGSLIQCFEWERIGEEEVDMTEGGGLTM 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 89/383 (23%)
AT1G66540NP_176827.2 p450 <4..375 CDD:386267 89/383 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.