DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP89A5

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_176675.1 Gene:CYP89A5 / 842803 AraportID:AT1G64950 Length:510 Species:Arabidopsis thaliana


Alignment Length:502 Identity:117/502 - (23%)
Similarity:207/502 - (41%) Gaps:73/502 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGG--------QHILFER 61
            :|| ::|:..:.:.|..|:..|  .||.|.:.|::| |:|:.::  .:||        .|.|   
plant    11 LFL-SLLLNLLFFRLRDSSSLP--LPPDPNYFPFIG-TIQWLRQ--GLGGLNNYLRSVHHRL--- 66

  Fly    62 WAKDFRSDLVGLKL-GREYVVVA---LGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGI-TCT 121
                  ..::.|:: .|..:.||   |.|:.:  |....||..||....:.......:..| :|.
plant    67 ------GPIITLRITSRPSIFVADRSLAHQAL--VLNGAVFADRPPAAPISKIISSNQHNISSCL 123

  Fly   122 DGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTE-EQPIEPVTWL--AQSVLNV 183
            .|..|...|.....::.:....|| ..|......|.|..:..:.. |:||..|..|  |...|.|
plant   124 YGATWRLLRRNLTSEILHPSRVRS-YSHARRWVLEILFDRFGKNRGEEPIVVVDHLHYAMFALLV 187

  Fly   184 LWCL---IAGKRIARQEDGTLRRLL-----DLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGYNL 240
            |.|.   :..|:|.:.|....|:||     :::|...|...    |:.:..|....         
plant   188 LMCFGDKLDEKQIKQVEYVQRRQLLGFSRFNILNLWPKFTK----LILRKRWEEFF--------- 239

  Fly   241 IQQLNTELYGFFMDTIE------EHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQL 299
              |:..|.:...:..|.      |.|:..:.:......:.:.:|:..:.:.....|....||.::
plant   240 --QMRREQHDVLLPLIRARRKIVEERKNRSSEEEEDNKEYVQSYVDTLLELELPDEKRKLNEDEI 302

  Fly   300 VMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMD 364
            |....:|...|:.||:..:...:..|...||:|::|:.::.:.|...:.:.....:::  ..|::
plant   303 VSLCSEFLNGGTDTTATALQWIMANLVKNPDIQKRLYEEIKSVVGEEANEVEEEDAQK--MPYLE 365

  Fly   365 AFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFID 429
            |.:||..|.........|......|.||||.:|||.||...:..:..|.:.|::|:.|:||||::
plant   366 AVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKNGTINFMVAEIGRDPKVWEEPMAFKPERFME 430

  Fly   430 SA-----GKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHF 471
            .|     .:..|   .||||.|||.|.|..||...:..::..:|:.|
plant   431 EAVDITGSRGIK---MMPFGAGRRICPGIGLAMLHLEYYVANMVREF 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 111/477 (23%)
CYP89A5NP_176675.1 CYP77_89 65..501 CDD:410698 101/442 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.