DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP79C2

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_176122.2 Gene:CYP79C2 / 842194 AraportID:AT1G58260 Length:530 Species:Arabidopsis thaliana


Alignment Length:524 Identity:123/524 - (23%)
Similarity:209/524 - (39%) Gaps:82/524 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SALIFLCAILIGFVIYSLISSARRPK-NFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKD 65
            |..:.|.:|.:...:....|...:|| ..|||||..|.:||.||......|    |:...|..::
plant     9 SFTLVLISITLVLALARRFSRFMKPKGQLPPGPRGWPIVGNMLQMIINRPA----HLWIHRVMEE 69

  Fly    66 FRSDLVGLKLGREYVVVALGHEMVKEV--QLQEVFEGRPDNFFLRLRTMGTRKGITCTDGQLW-Y 127
            .::|:...:..|.:|:.....::.:||  :..||...|.:::...|.:.|.:.....:.|:.| .
plant    70 LQTDIACYRFARFHVITVTSSKIAREVLREKDEVLADRSESYASHLISHGYKNISFSSYGENWKL 134

  Fly   128 EHRHFAMKQM------RNVGYGRSQMEHHIELEAEEL---------LGQLERTEEQPIEPVTWLA 177
            ..:....|.|      :.:||.        .:||:.:         ||.:.:    ||.    :.
plant   135 VKKVMTTKLMSPTTLSKTLGYR--------NIEADNIVTYVYNLCQLGSVRK----PIN----VR 183

  Fly   178 QSVLN----VLWCLIAGKRIARQ--EDGTL----RRLLDLMNRRSKLFDICGGLLAQFPWLRHVA 232
            .::|.    |:..::.|:|...:  |:|.|    :..:|.:......| ....|....|:||   
plant   184 DTILTYCHAVMMRMMFGQRHFDEVVENGGLGPKEKEHMDAIYLALDCF-FSFNLTNYIPFLR--- 244

  Fly   233 PDRTGYNLIQQLNTE------LYGFFMDTIEEHRRQL--AKDPSPAESDLIYAYLQEMKDRSAGG 289
                |:| :.:..||      :.....|.|.:.|..|  .|.....|.|.: ..|..:|| ..|.
plant   245 ----GWN-VDKAETEVREAVHIINICNDPIIQERIHLWRKKGGKQMEEDWL-DILITLKD-DQGM 302

  Fly   290 ESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHL 354
            ...||:|.:.....::  :|....|.|.:...:..:...|::.||..:::...|   ..|.....
plant   303 HLFTFDEIRAQCKEIN--LATIDNTMNNVEWTIAEMLNHPEILEKATNELDIIV---GKDRLVQE 362

  Fly   355 SRREAFDYMDAFIMEVQRFFHITPITGPRR-ALWATKLGGYDIPKNATILISLRSVHLDKEHWKD 418
            |.....:|:.|...|..| .|...:..|.. |...|.|.||.:||.:.||:|...:..:.:.|.:
plant   363 SDISQLNYIKACSKESFR-LHPANVFMPHHVAREDTTLAGYFVPKGSQILVSRLGLGRNPKIWDE 426

  Fly   419 PLEFRPERFID-----SAGKCF--KDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLP 476
            |..|:|||::|     |.|...  .|..|:.||.|||.|.|..:..:.....|.|::|.|...||
plant   427 PNAFKPERYLDGHVEKSLGVTLMEPDMRFVTFGTGRRSCPGTKIGTSMTIMLLARLIQGFEWTLP 491

  Fly   477 AGES 480
            .|:|
plant   492 IGKS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 117/495 (24%)
CYP79C2NP_176122.2 p450 10..529 CDD:386267 122/523 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.