DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP76C6

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_174633.1 Gene:CYP76C6 / 840263 AraportID:AT1G33720 Length:511 Species:Arabidopsis thaliana


Alignment Length:534 Identity:124/534 - (23%)
Similarity:202/534 - (37%) Gaps:125/534 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIFLCAILIGFVIYSLISSARRP---KNFPPGPRFVPWLGNTLQFRKEASAVG-GQHILFERWAK 64
            ||| |.||...:.::...|.|.|   ...||||..:|.:||       ...|| ..|..|...:|
plant    11 LIF-CFILSCLLFFTTARSRRSPCQLSKSPPGPPRLPIIGN-------IHLVGKNPHHSFTDLSK 67

  Fly    65 DFRSDLVGLKLGREYVVVALGHEMVKEV--QLQEVFEGR--------------------PDNFFL 107
            .: ..::.||||....||....:.|:||  ...::..||                    |.:...
plant    68 TY-GPVMSLKLGCLNSVVIASRDAVREVLKTHDQILSGRYISEATKSNNHHEFSVGWIHPSSSRF 131

  Fly   108 RLRTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQL----ERTEEQ 168
            |:    .|| ::.|  ||:......|.|.:|        |:     :.:||:..|    ||.|..
plant   132 RM----LRK-LSAT--QLFSPQCIQATKALR--------MK-----KVQELVNFLSESCEREEAV 176

  Fly   169 PIEPVTWLA--QSVLNVLWCLIAGKRIARQEDG---------------------TLRRLLDLMNR 210
            .|..|:::.  ..:.|:|:.:..|...::....                     ...|.|||...
plant   177 DISHVSFVTALNIISNILFSVNLGSYDSKNSSAFQEMVIGYQESIGNPDLANFFPFMRFLDLQGN 241

  Fly   211 RSKLFDICGGLLAQFPWLRHVAPDRTGYNLIQQLNTELYGFFMDT--IEEHRRQLAKDPSPAESD 273
            ..|:.:..|.||                        :::..|.|.  :|:..|.:.||.|..:  
plant   242 SKKMRESSGRLL------------------------QVFREFYDARIVEKSSRSVEKDVSSKD-- 280

  Fly   274 LIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQ 338
                :|..:.|...|.|:. .|..::...:||.|:||:.|.|:|:..|:..|...|....|:..:
plant   281 ----FLDVLIDLQQGDETE-INIDEIEHLLLDMFVAGTDTNSSTVEWAMAELLGNPKTMTKVQDE 340

  Fly   339 VTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATIL 403
            :...:..........:|:   ..|:.|.:.|..|.....|....|:|....::.|:.:.|::.:|
plant   341 INHVIGQNGDFQESDISK---LPYLKAVVKETFRLHPAAPFLLQRKAETNVEILGFTVLKDSQVL 402

  Fly   404 ISLRSVHLDKEHWKDPLEFRPERF----IDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFL 464
            :::.::..|...|::|..|.||||    ||..|   .|....|||.|||.|.|..||...:...|
plant   403 VNVWAIGRDPLVWENPTHFEPERFLGKEIDVKG---TDYELTPFGAGRRICPGLPLAMKTVHLML 464

  Fly   465 VRIVQHFSVVLPAG 478
            ..::..|...||.|
plant   465 ASLLYTFEWKLPNG 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 115/505 (23%)
CYP76C6NP_174633.1 p450 11..504 CDD:299894 124/534 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.