DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP78A5

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_172827.1 Gene:CYP78A5 / 837932 AraportID:AT1G13710 Length:517 Species:Arabidopsis thaliana


Alignment Length:527 Identity:111/527 - (21%)
Similarity:197/527 - (37%) Gaps:107/527 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIFLCAILIGFVIYSLISSARRPKNF--PPGPRFVPWLGNTLQFRKEASAVG-----------GQ 55
            |.|....|:.|..::.:|.......|  .||.....|.|::   :...|..|           ..
plant     8 LFFNSFNLVTFEAFASVSLIIATVAFLLSPGGLAWAWTGSS---KSRVSIPGPSGSLSVFSGSNP 69

  Fly    56 HILFERWAKDFR-SDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRP--DNFFLRL--RTMGTR 115
            |.:....||.|: |.|:...:|....|::...|..||:.....|..||  ::.:..|  |.||  
plant    70 HRVLAALAKRFKASPLMAFSVGFSRFVISSEPETAKEILSSSAFADRPVKESAYELLFHRAMG-- 132

  Fly   116 KGITCTDGQLW-----------YEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQP 169
               ....|:.|           :..|..|..:...||.|...::....|...:..|::|      
plant   133 ---FAPYGEYWRNLRRISSTHLFSPRRIASFEGVRVGIGMKMVKKIKSLVTSDACGEVE------ 188

  Fly   170 IEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGG-------------- 220
                                .|:|.  ..|:|..::..:...|..||...|              
plant   189 --------------------VKKIV--HFGSLNNVMTTVFGESYDFDEVNGKGCFLERLVSEGYE 231

  Fly   221 LLAQFPWLRHV----APDRTGYN-----LIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIY 276
            ||..|.|..|.    ..|..|..     |:.::||.:.|.    ||:|:.:...:.:..|:|.:.
plant   232 LLGIFNWSDHFWFLRWFDFQGVRKRCRALVSEVNTFVGGI----IEKHKMKKGNNLNGEENDFVD 292

  Fly   277 AYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTA 341
            ..|...||..       .:::.::..:.:....|:.|.:..:...|..:.:..|:|:||:.:   
plant   293 VLLGLQKDEK-------LSDSDMIAVLWEMIFRGTDTVAILVEWVLARMVLHQDIQDKLYRE--- 347

  Fly   342 SVAAASTDAFPHLSRRE--AFDYMDAFIMEVQRFFHITP-ITGPRRALWATKLGGYDIPKNATIL 403
             :|:|:::....||..:  ...|:.|.:.|..|.....| ::..|.|:....:|...:|.....:
plant   348 -IASATSNNIRSLSDSDIPKLPYLQAIVKETLRLHPPGPLLSWARLAIHDVHVGPNLVPAGTIAM 411

  Fly   404 ISLRSVHLDKEHWKDPLEFRPERFI-DSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRI 467
            :::.|:..:.:.|.||..|.||||| :.......|....|||.|||.|.|.|:..|.:..::.::
plant   412 VNMWSITHNAKIWTDPEAFMPERFISEDVSIMGSDLRLAPFGSGRRVCPGKAMGLATVHLWIGQL 476

  Fly   468 VQHFSVV 474
            :|:|..|
plant   477 IQNFEWV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 105/499 (21%)
CYP78A5NP_172827.1 CYP78 81..505 CDD:410699 95/451 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.