DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP89A3

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_200940.1 Gene:CYP89A3 / 836253 AraportID:AT5G61320 Length:497 Species:Arabidopsis thaliana


Alignment Length:522 Identity:121/522 - (23%)
Similarity:201/522 - (38%) Gaps:129/522 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAILIGFVIYSLISSARRPKN---FPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKDF 66
            ||..:..:.|::|...   ||..|   .||.|.|.|..| ..|:.::.         |:    ||
plant     7 IFCVSFTVNFLLYLFF---RRTNNNLPLPPNPNFFPMPG-PFQWLRQG---------FD----DF 54

  Fly    67 RSDLVGL--KLG-----REYVVVA-------LGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKG 117
            .|.|..:  :||     |.:.|.|       |.|:.:  |....||..||.       .:.|.|.
plant    55 YSYLRSIHHRLGPIISLRIFSVPAIFVSDRSLAHKAL--VLNGAVFSDRPP-------ALPTGKI 110

  Fly   118 ITCTD--------GQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEA---------EELLGQLER- 164
            ||...        |..|...|       ||:   .|::.|...:::         |.|..::.. 
plant   111 ITSNQHTISSGSYGATWRLLR-------RNL---TSEILHPSRVKSYSNARRSVLENLCSRIRNH 165

  Fly   165 -TEEQPIEPVTWLAQSVLNVLWCLIAGKR-----------IARQEDGTLRR--LLDLMNRRSKLF 215
             .|.:||..|..|..::.::|..:..|.:           :.|:|..||.|  :|::....:|||
plant   166 GEEAKPIVVVDHLRYAMFSLLVLMCFGDKLDEEQIKQVEFVQRRELITLPRFNILNVFPSFTKLF 230

  Fly   216 DICGGLLAQFPWLRHVAPDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQ 280
                   .:..|...:...|...|::..|            ...||::..:...:..:.|.:|:.
plant   231 -------LRKRWEEFLTFRREHKNVLLPL------------IRSRRKIMIESKDSGKEYIQSYVD 276

  Fly   281 EMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAA 345
            .:.|.....|....||.::|....:|..||:.||:.|:...:..|.:..:.::::..:       
plant   277 TLLDLELPDEKRKLNEDEIVSLCSEFLNAGTDTTATTLQWIMANLVIGEEEEKEIEEE------- 334

  Fly   346 ASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVH 410
                      ..:...|:.|.::|..|......:..|.|....|:||||.:||..|..|::..:.
plant   335 ----------EMKKMPYLKAVVLEGLRLHPPGHLLLPHRVSEDTELGGYRVPKKGTFNINVAMIG 389

  Fly   411 LDKEHWKDPLEFRPERFI------DSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQ 469
            .|...|::|:||:|||||      |..|.  :....||||.|||.|.|...|...:..|:|.:|:
plant   390 RDPTVWEEPMEFKPERFIGEDKEVDVTGS--RGIKMMPFGAGRRICPGIGSAMLHLEYFVVNLVK 452

  Fly   470 HF 471
            .|
plant   453 EF 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 114/494 (23%)
CYP89A3NP_200940.1 PLN00168 42..488 CDD:215086 109/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.