DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP81D1

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_568533.2 Gene:CYP81D1 / 833619 AraportID:AT5G36220 Length:502 Species:Arabidopsis thaliana


Alignment Length:506 Identity:120/506 - (23%)
Similarity:197/506 - (38%) Gaps:96/506 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGFVIYSLIS--------SARRPK--NFPPG-PRFVPWLGNTLQFRKEASAVGGQHILFERWAKD 65
            |..|:||:.|        ...:||  |.||. |.::|.:|: |:..|..         ..|..:.
plant     6 IRVVLYSIFSLIFLIISFKFLKPKKQNLPPSPPGWLPIIGH-LRLLKPP---------IHRTLRS 60

  Fly    66 FRSDL--------VGLKLGREYVVVALGHEMVKEV---QLQEVFEGRPDNFFLRLRTMGTRKGIT 119
            |...|        :.|:||...|.|...|::..|.   :...|...||...      :|...|..
plant    61 FSETLDHNDGGGVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVI------IGKHVGYN 119

  Fly   120 CTD------GQLWYEHRH------FAMKQMRNVGYGRSQMEHHIELEAEELLGQLER---TEEQP 169
            .|:      |..|...|.      |:..::....|.|:.       |...|:.:|.|   |::..
plant   120 NTNMIAAPYGDHWRNLRRLCTIEIFSTHRLNCFLYVRTD-------EVRRLISRLSRLAGTKKTV 177

  Fly   170 IEPVTWLAQSVLNVLWCLIAGKRIARQE---DGTLRRLLDLMNRRSKLFDI-----CGGLLAQFP 226
            :|....|.....|.:..::.|||...:|   :...:|:      |..:.|:     .|..:...|
plant   178 VELKPMLMDLTFNNIMRMMTGKRYYGEETTDEEEAKRV------RKLVADVGANTSSGNAVDYVP 236

  Fly   227 WLRHVAPDRTGY-NLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGE 290
            .||..    :.| |.:::|..|...|....|::.|.|.....:..:..|:   ||:       .:
plant   237 ILRLF----SSYENRVKKLGEETDKFLQGLIDDKRGQQETGTTMIDHLLV---LQK-------SD 287

  Fly   291 SSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLS 355
            ...:.:..:...||...|||:.|::.|:..||..|...|||..|...::...|   ..|.....:
plant   288 IEYYTDQIIKGIILIMVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRV---GLDRLIEEA 349

  Fly   356 RREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPL 420
            ......|:...::|..|....||:..|..|....|:|.||:|:..|:|::..::|.|...|.||.
plant   350 DLSELPYLKNIVLETLRLHPATPLLVPHMASEDCKIGSYDMPRGTTLLVNAWAIHRDPNTWDDPD 414

  Fly   421 EFRPERFIDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHF 471
            .|:||||    .|..:.:..:.||:|||.|.|..||:..:...|..::|.|
plant   415 SFKPERF----EKEEEAQKLLAFGLGRRACPGSGLAQRIVGLALGSLIQCF 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 112/478 (23%)
CYP81D1NP_568533.2 p450 15..489 CDD:386267 116/497 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.