DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71B8

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_680342.2 Gene:CYP71B8 / 833546 AraportID:AT5G35715 Length:442 Species:Arabidopsis thaliana


Alignment Length:348 Identity:87/348 - (25%)
Similarity:141/348 - (40%) Gaps:80/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 RIARQEDGTL-----------RRLLDLMNRRSKLFDICGGLLAQ--------------------- 224
            |..|:|:|.|           :.|:||   |...|....|::.:                     
plant    79 RYIREEEGDLLVKKLSKSSQTQTLVDL---RKAFFSFTAGIIFRVSFGQNFRECDFIDMDRLEEL 140

  Fly   225 ----------------FP----WLRHVAPDRTG--YNLIQQLNTELYGFFMDTIEEHRRQLAKDP 267
                            ||    ||    .||..  ::.|::..::|..||...|:|   :|....
plant   141 VQESETNVFSFAFTDFFPTGLGWL----VDRISGQHSRIEKAFSKLTKFFQHVIDE---ELKIGQ 198

  Fly   268 SPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQ 332
            |...|:|:.:.| :|.:||....|.......|:..:.|..:.|....:.|:...:..|...|.|.
plant   199 SQDHSNLVSSML-DMINRSTEYGSFKITSDHLIAMMTDIVLGGVNAGTITMIWTMTELTRHPRVM 262

  Fly   333 EKLFSQVTASVAAASTDAFPHLSR-----REAFDYMDAFIMEVQRFFHITPITGPRRALWATKLG 392
            :||..::.|::.       |:..|     .|..:|:...|.|..|.....|...||:.:...::.
plant   263 KKLREEIRATLG-------PNKERITEEDLEKVEYLKLVIKETFRLHPPGPFLLPRQVMSDIEIQ 320

  Fly   393 GYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFKDEYF--MPFGMGRRRCLGDAL 455
            ||.|||||.|.||..::..|.:.|.:|.||.||||.:::.. :|.:::  :|||.|||.|.|..|
plant   321 GYHIPKNAHIKISTYAIGRDPKCWTNPEEFNPERFANTSIN-YKGQHYELLPFGAGRRSCPGMTL 384

  Fly   456 ARACIFSFLVRIVQHFSVVLPAG 478
            ....:...|:.|:.:|...||.|
plant   385 GITILELGLLNILYYFDWSLPNG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 87/348 (25%)
CYP71B8NP_680342.2 p450 3..434 CDD:299894 87/348 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.