DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP78A7

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_196559.1 Gene:CYP78A7 / 830858 AraportID:AT5G09970 Length:536 Species:Arabidopsis thaliana


Alignment Length:520 Identity:112/520 - (21%)
Similarity:202/520 - (38%) Gaps:106/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAILIGFVIYSLISSA---------RRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFE 60
            :||..:.:..|.::|....         |..:...||||.:|..|:.....:   .:..:.:...
plant    36 LFLAVVFLSIVTWALAGGGGVAWKNGRNRLGRVAIPGPRGIPVFGSLFTLSR---GLAHRTLAAM 97

  Fly    61 RWAKDFRSDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRP----DNFFLRLRTMGTRKGITCT 121
            .|:: ..::::...||...|:||....:.:|:.:...|..||    ....:..|.:|     ...
plant    98 AWSR-ANTEIMAFSLGSTPVIVASEPNIAREILMSPHFADRPVKQSAKSLMFSRAIG-----FAP 156

  Fly   122 DGQLWYEHRH------FAMKQMRNVGYGRSQMEHHIELEAEELLG--QLERTEEQPIEPVTWLAQ 178
            :|..|...|.      ||.:::.....||       :|:..|::.  .:|:.....:.....|..
plant   157 NGTYWRMLRRIASTHLFAPRRILAHEAGR-------QLDCAEMVKAVSVEQNGAGSVVLRKHLQL 214

  Fly   179 SVLNVLWCLIAGKR---IARQEDGTLRRLLDLMNRRSKLFDICGGL--LAQFPWLRHVAPDRTGY 238
            :.||.:...:.|:|   :|::||     |.:|.:...:.|::.|..  ....|||          
plant   215 AALNNIMGSVFGRRYDPLAQKED-----LDELTSMVREGFELLGAFNWSDYLPWL---------- 264

  Fly   239 NLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQE------MKDRSAG--------- 288
                       |:|.|:|..::|  ..|..|....|:...:.|      .|.|..|         
plant   265 -----------GYFYDSIRLNQR--CSDLVPRIRTLVKKIIDEHRVSNSEKKRDIGDFVDVLLSL 316

  Fly   289 -GESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVA-AASTD-A 350
             |:.. ..|..::..:.:....|:.||:......:..|.:.|:||.||..::..:|. .|..| |
plant   317 DGDEK-LQEDDMIAVLWEMIFRGTDTTALLTEWTMAELVLNPNVQTKLRDEILTAVGDGADGDVA 380

  Fly   351 FPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWA------TKL-GGYDIPKNATILISLRS 408
            ...|::   ..|::|.:.|..|.....|:..     ||      .:| .|..|||..|.::::.:
plant   381 DADLAK---LPYLNAVVKETLRLHPPGPLLS-----WARLSTSDVQLSNGMVIPKGTTAMVNMWA 437

  Fly   409 VHLDKEHWKDPLEFRPERFIDSAGKCFK--DEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHF 471
            :..|:..|.|||:|.||||..:|....:  |....|||.|||.|.|..:..|.:..::..:|:.|
plant   438 ITHDQTVWSDPLKFDPERFTGNADMDIRGGDLRLAPFGAGRRVCPGKNMGLATVTRWVAELVRRF 502

  Fly   472  471
            plant   503  502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 107/486 (22%)
CYP78A7NP_196559.1 CYP78 103..528 CDD:410699 100/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.