DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP81F4

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_195457.1 Gene:CYP81F4 / 829895 AraportID:AT4G37410 Length:501 Species:Arabidopsis thaliana


Alignment Length:527 Identity:112/527 - (21%)
Similarity:200/527 - (37%) Gaps:101/527 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAILIGFVIYSLISSARRPKNF-PPGPRF-VPWLGNTLQFRKEASAVGGQHILFERWAKDFR 67
            :.:..:.:..:.|....::::.:.: ||.|.: :|.||:.|..:...      |.||.| ..:..
plant     5 VIILPLALFLLAYKFFFTSKKQRYYLPPSPSYSLPILGHHLLIKPPV------HRLFHR-LSNIH 62

  Fly    68 SDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGI--------TCTDGQ 124
            ..:..|:||....||.....:.:     |.|.|:.|..........|.|.|        |.:.|.
plant    63 GPIFYLRLGSRRAVVISSSSLAR-----ECFTGQNDVIVSNRPRFLTSKYIAYNYTTIATTSYGD 122

  Fly   125 LWYEHRHF------AMKQMRNVGYGRSQMEHHIELEAEELLGQLERT----EEQPIEPVTWLAQS 179
            .|...|..      :.|::.|..:.|.:       |.:.:|.:|.|.    :|..:|.:  |...
plant   123 HWRNLRRICSLEIVSSKRLANFLHIRKE-------EIQRMLTRLSRDARVGKEVELESI--LYDL 178

  Fly   180 VLNVLWCLIAGK-----RIARQEDGTL-RRLLDLMNRRS------------KLFDICGGLLAQFP 226
            ..|.:..::.||     .::.:|:..| ::|...:...|            |:|   ||...:..
plant   179 TFNNIVRMVTGKIYYGDDVSDKEEAELFKKLFTFITTNSGARHPGEYLPFMKIF---GGSFEKEV 240

  Fly   227 WLRHVAPDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGES 291
            .......|.....|:.:..::..|   :|:..|...|.:|.....:|:|...|            
plant   241 KAAAKVIDEMLQRLLDECKSDKDG---NTMVNHLLSLQQDDPEYYTDIIIKGL------------ 290

  Fly   292 STFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSR 356
                       :|...:|.|:|::.||..|:..|...|.|.:|:..::...:   ..|.....|.
plant   291 -----------MLGIMVASSETSALTIEWAMASLLNHPKVLDKVKLEIDEII---GQDRLIEESD 341

  Fly   357 REAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLE 421
            .....|:...:.|..|.....|:..||......|:||||:|::..::::..::|.|.:.|.:|..
plant   342 IANLPYLQNVVSETLRLHPAAPVLVPRSTAEDIKIGGYDVPRDTMVMVNAWAIHRDPDLWTEPER 406

  Fly   422 FRPERFIDSAGKCFKDEYFM--PFGMGRRRCLGDALARACIFSFLVRIVQHF------SVVLPAG 478
            |.||||  :.|:..||:..|  .||.|||.|.|..||...:...|..::|.|      ...:...
plant   407 FNPERF--NGGEGEKDDVRMLIAFGSGRRICPGVGLAHKIVTLALGSLIQCFDWKKVNEKEIDMS 469

  Fly   479 ESPSMVL 485
            |.|.|.:
plant   470 EGPGMAM 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 111/501 (22%)
CYP81F4NP_195457.1 CYP81 63..482 CDD:410746 100/462 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.