DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP81D3

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_195451.1 Gene:CYP81D3 / 829889 AraportID:AT4G37340 Length:500 Species:Arabidopsis thaliana


Alignment Length:512 Identity:117/512 - (22%)
Similarity:202/512 - (39%) Gaps:60/512 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIFLCAILIGFVIYSLISSARRPKNFPPGPRF-VPWLGNTLQFRKEASAVGGQHILFERWAKDF- 66
            ||| ..:.|...:..:|...:|..|.||.|.: :|.:|: |:..|..     .|.:|...::.. 
plant     6 LIF-TFLFISLSLTFIIGRIKRRPNLPPSPSWALPVIGH-LRLLKPP-----LHRVFLSVSESLG 63

  Fly    67 RSDLVGLKLGREYVVVALGHEMVKE--VQLQEVFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEH 129
            .:.::.|:||...|.|...|.:.:|  .:...|...|.::...:..:.|....:|.:.|..|   
plant    64 DAPIISLRLGNRLVFVVSSHSLAEECFTKNDVVLANRFNSLASKHISYGCTTVVTASYGDHW--- 125

  Fly   130 RHFAMKQMRNVGYGRSQMEHHIEL-------EAEELLGQLERT---EEQPIEPVTWLAQSVLNVL 184
                 :.:|.:|.......|.:..       |...|:..|.|.   |...:|..:..:....|.:
plant   126 -----RNLRRIGAVEIFSAHRLNSFSSIRRDEIHRLIACLSRNSSLEFTKVEMKSMFSNLTFNNI 185

  Fly   185 WCLIAGKRI---ARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTG-YNLIQQLN 245
            ..::|||..   ..::|...:|:.:|:......|. .|......|.|..:    || ...|:::.
plant   186 IRMLAGKCYYGDGAEDDPEAKRVRELIAEGMGCFG-AGNTADYLPILTWI----TGSEKRIKKIA 245

  Fly   246 TELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAG 310
            :.|..|....::|.|....|..:.....|:  .|||.:.     |..|.|..:.:|  |...:||
plant   246 SRLDEFLQGLVDERREGKEKRQNTMVDHLL--CLQETQP-----EYYTDNIIKGIM--LSLILAG 301

  Fly   311 SQTTSNTINLALMVLAMRPDVQEKLFSQVTASVA---AASTDAFPHLSRREAFDYMDAFIMEVQR 372
            :.|::.|:...|..|...|.:..|...::...|.   ........||      .|:...:.|..|
plant   302 TDTSAVTLEWTLSALLNHPQILSKARDEIDNKVGLNRLVEESDLSHL------PYLQNIVSESLR 360

  Fly   373 FFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFKD 437
            .:..:|:..|..|....|:|||.:|:...:|.:..::|.|.:.|.||..|:|||| :..|:..| 
plant   361 LYPASPLLVPHVASEDCKVGGYHMPRGTMLLTNAWAIHRDPKIWDDPTSFKPERF-EKEGEAQK- 423

  Fly   438 EYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGESPSMVLLPGITLTPK 494
              .:.||:|||.|.|..||:......:..::|.|.......|...|....|..:.||
plant   424 --LLGFGLGRRACPGSGLAQRLASLTIGSLIQCFEWERIGEEEVDMTEGGGGVIMPK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 110/486 (23%)
CYP81D3NP_195451.1 p450 5..489 CDD:299894 117/512 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.