DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP82C2

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_194925.1 Gene:CYP82C2 / 829327 AraportID:AT4G31970 Length:523 Species:Arabidopsis thaliana


Alignment Length:538 Identity:128/538 - (23%)
Similarity:213/538 - (39%) Gaps:80/538 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SALIFLCAILIGFVIYSLISSARRPKNF-PPGPRFV-PWLGNTLQFRKEASAVGGQHILFERWAK 64
            ::|..|...::.||..:|...:::||:. .|.|... |.:|:.....      |.:.:|:....|
plant     3 TSLFSLFVPILVFVFIALFKKSKKPKHVKAPAPSGAWPIIGHLHLLS------GKEQLLYRTLGK 61

  Fly    65 --DFRSDLVGLKLGREYVVVALGHEMVKE--VQLQEVFEGRPDNFFLRLRTMGTRKGITCT---- 121
              |.....:.|:||.....|....|:.|:  ....:....||      :.......|..|.    
plant    62 MADQYGPAMSLRLGSSETFVVSSFEVAKDCFTVNDKALASRP------ITAAAKHMGYDCAVFGF 120

  Fly   122 --DGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQ------LERTEEQP--IEPVTWL 176
              ....|.|.|..|..::  :...|.||..|:.:....::.|      :::...:|  ::..:||
plant   121 APYSAFWREMRKIATLEL--LSNRRLQMLKHVRVSEISMVMQDLYSLWVKKGGSEPVMVDLKSWL 183

  Fly   177 AQSVLNVLWCLIAGKRI-------------ARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFP-- 226
            ....||::..::||||.             |||....:.....|:.    :|.:...    ||  
plant   184 EDMSLNMMVRMVAGKRYFGGGSLSPEDAEEARQCRKGVANFFHLVG----IFTVSDA----FPKL 240

  Fly   227 -WLRHVAPDRTGYNL-IQQLNTELYGFFMDTIEEHRRQ-LAKDPSPAESDLIYAYLQEMKDRSAG 288
             |.     |..|:.. ::|...||.......||.||:| ........:||    ::..|...:..
plant   241 GWF-----DFQGHEKEMKQTGRELDVILERWIENHRQQRKVSGTKHNDSD----FVDVMLSLAEQ 296

  Fly   289 GESSTFNE---TQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDA 350
            |:.|....   |.:..|.|...:.||:|:.:|:..|:.:|....|:.:|...::...|   ..|.
plant   297 GKFSHLQHDAITSIKSTCLALILGGSETSPSTLTWAISLLLNNKDMLKKAQDEIDIHV---GRDR 358

  Fly   351 FPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEH 415
            ....|..|...|:.|.|.|..|.:...|:.|.|.|:....:.||::.:...:|:::..:..|...
plant   359 NVEDSDIENLVYIQAIIKETLRLYPAGPLLGHREAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRV 423

  Fly   416 WKDPLEFRPERFIDSAGKCF--KDEYF--MPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLP 476
            :.:|.||||||||....|.|  :.:.|  ||||.|||.|.|.:||...:...|.|.:|.|.|...
plant   424 YMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTV 488

  Fly   477 AGESPSMVLLPGITLTPK 494
            ......|...||:|: ||
plant   489 MDMPVDMTESPGLTI-PK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 121/509 (24%)
CYP82C2NP_194925.1 CYP82 67..516 CDD:410747 113/468 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.