DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71B32

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_680127.1 Gene:CYP71B32 / 824498 AraportID:AT3G53305 Length:338 Species:Arabidopsis thaliana


Alignment Length:236 Identity:58/236 - (24%)
Similarity:97/236 - (41%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 YAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTI-NLALMVLAMRPD------VQE 333
            :.|::|.:......:.|...:||   |::|...|....|:.|| .||......:.|      ::|
plant    78 FRYIREEEGDLLVKKISNSAQTQ---TLIDLRKASFSFTAGTIFRLAFGQNFHQCDFMDMDRLEE 139

  Fly   334 KLFSQVTASVAAASTDAFP----------------------HLSRREAFDYMDAFIMEVQRFFHI 376
            .:....|.....|.||..|                      :.:..:..:|::..|.|..|....
plant   140 LVLEAETNGCILALTDFLPTGLGWLVDRISGCGFGGSECGNNHNDLQKVEYLNMVIKETFRLHPP 204

  Fly   377 TPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSA----GKCFKD 437
            :|:..||..:...::.||.|||||.|.|:..::..|.:.|.:     ||||::::    |:.:| 
plant   205 SPLLLPRETMSDIEIQGYHIPKNALIRINTYTIGRDLKCWSN-----PERFLNTSINYKGQDYK- 263

  Fly   438 EYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAG 478
              .:|||.|||.|.|..|....:...|:.|:..|....|.|
plant   264 --LLPFGAGRRSCPGMNLGITILELGLLNILYFFDWSFPNG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 58/236 (25%)
CYP71B32NP_680127.1 p450 3..311 CDD:299894 58/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.