DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71B31

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_190898.1 Gene:CYP71B31 / 824497 AraportID:AT3G53300 Length:498 Species:Arabidopsis thaliana


Alignment Length:515 Identity:127/515 - (24%)
Similarity:213/515 - (41%) Gaps:92/515 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQ----FRKEASAVGGQH--ILFERW 62
            |:||..:.  |:::..:...|  |..||||..:|.:||..|    .......:..:|  ::..||
plant     7 LLFLFPLF--FILFKNLLPPR--KKLPPGPTGLPLIGNLHQLGRLLHSSLHKLSLEHGPVMLVRW 67

  Fly    63 AKDFRSDLVGLKLGREYVVVALGHEMVKEVQLQEVFE--GRPDNFFLRLRTMGTRKGITCTD-GQ 124
                         |...:.|...:|..|||......|  .||......|.|.| .|.|..|. |:
plant    68 -------------GVVPMAVFSSNEAAKEVLKTHDLETCNRPKLVANGLFTHG-YKDIGFTQYGE 118

  Fly   125 LWYEHRH------FAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNV 183
            .|.|.:.      |:.|:.::..|.|       |.|.:.|:.::....:         .|:::::
plant   119 EWREMKKFVGLELFSPKKHKSFRYIR-------EEEGDLLVKKISNYAQ---------TQTLVDL 167

  Fly   184 LWCLIA--GKRIARQEDGTLRRLLDLMNRRSKL--------FDICGGLLAQF-----PWL-RHVA 232
            ...|.:  ...|.|:..|...|..|.:| ..||        .::|......|     .|| ..::
plant   168 RKSLFSYTASIIFREAFGQNFRECDYIN-MDKLEELVQETETNVCSLAFTDFFPRGLGWLVDRIS 231

  Fly   233 PDRTGYNL-IQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEM-KDRSAGGESSTFN 295
            ...:..|: ..:|.|    ||.|.|:|..:....|.   .|||:.|.|..: :.|..|....|::
plant   232 GQHSRMNIAFSKLTT----FFEDVIDELLKTKQLDD---HSDLVTAMLDVINRPRKFGSLKITYD 289

  Fly   296 ETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSR---- 356
              .|:..:.|..:||....:.|:...:..|...|.|.:||..::.|::.       |:..|    
plant   290 --HLIAMMSDVVLAGVNAGTVTMIWTMTELTRHPRVMKKLQEEIRATLG-------PNKERITEE 345

  Fly   357 -REAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPL 420
             .|..:|::..|.|..|.....|:..||..:...::.||.|||||.:.|:..::..|.:.|.:|.
plant   346 DLEKVEYLNLVIKESFRLHPPAPLLLPRETMSDIEIQGYHIPKNAHVKINTYAIGRDPKRWTNPE 410

  Fly   421 EFRPERFIDSAGKCFKDEYF--MPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAG 478
            ||.||||::::.. :|.:::  :|||.|||.|.|..|....:...|:.|:.:|...||:|
plant   411 EFNPERFLNTSIN-YKGQHYELLPFGAGRRNCPGMTLGITILELGLLNILYYFDWSLPSG 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 121/489 (25%)
CYP71B31NP_190898.1 CYP71-like 58..491 CDD:410695 113/460 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.