DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71A24

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001190031.2 Gene:CYP71A24 / 823987 AraportID:AT3G48290 Length:514 Species:Arabidopsis thaliana


Alignment Length:534 Identity:112/534 - (20%)
Similarity:198/534 - (37%) Gaps:111/534 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALIFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQH------ILF 59
            |..::.||:|::..:::....|..:..|.||.|..:|.:.|..|.        |:|      .|.
plant     5 MMIILLLCSIILITILFFKKQSRGKKSNAPPSPPRLPLIRNLHQL--------GRHPHRSLCSLS 61

  Fly    60 ERWAKDFRSDLVGLKLGREYVVVALGHEMVKEV--QLQEVFEGRP-----DNFFLRLRTMGTRKG 117
            .|:     ..|:.|..|...|:|....:..|:|  ....||..||     |..|...|.:.    
plant    62 HRY-----GPLMLLHFGSVPVLVVSSADAAKDVLKTHDRVFASRPRSKIFDKIFYNGRDVA---- 117

  Fly   118 ITCTDGQLWYEHRH------FAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWL 176
             ....|:.|.:.:.      |:.|.:|:.   |...:..|.|..|::     |........::.:
plant   118 -LAPYGEYWRQMKSVCVLHLFSNKMVRSF---RDVRQEEISLMIEKI-----RISSSLRINLSEI 173

  Fly   177 AQSVLNVLWCLIA-GKRIARQEDGTLRRLLDLMNRRSKL---FDICG--GLLAQFPWLRHVAPDR 235
            ..::.|.:.|.:| |::...:.|     ..|||.|.::|   |.:..  ..||...|:|.:.   
plant   174 LVNLTNNVICRVALGRKYGGKTD-----FKDLMKRLTRLLGEFSVGSYVSWLAWIDWIRGLD--- 230

  Fly   236 TGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLV 300
               ..:.:::.:|..|....:::|     .|....::|.:...|...:::|.|.|....:...::
plant   231 ---GQLIKISNDLDEFLERVVQDH-----VDGDGHKNDFVDFLLTIEREKSVGFEIDRLSIKAII 287

  Fly   301 MT-----------------------ILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQ---V 339
            :.                       ..|.|:....||...:..|:..|....:..::|..:   |
plant   288 LVKGRYENKFKFTDELVYNHSSCFGFQDVFVGDMDTTYTLLEWAMTELLCHHECLDRLQEEVRMV 352

  Fly   340 TASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILI 404
            ....:..|.|....:.      |:.|.|.|..|.....|:..|..:....||..|.||....::|
plant   353 CKDKSGVSEDDLQDMK------YLKAVIKETLRLHPPLPLMVPHESTHDVKLRDYHIPAGTHVMI 411

  Fly   405 SLRSVHLDKEHW-KDPLEFRPER----FIDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFS-- 462
            :..::..:...| .|..||||||    ::|..|   :|...:|||.|||.|  .|::.|.:..  
plant   412 NAWAIGREAATWGPDAEEFRPERHLNSYVDYRG---QDTELVPFGAGRRIC--PAISFAVVLDEV 471

  Fly   463 FLVRIVQHFSVVLP 476
            .|..:|..|...||
plant   472 VLANLVHQFDWTLP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 106/505 (21%)
CYP71A24NP_001190031.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.