DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71A26

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_680106.1 Gene:CYP71A26 / 823985 AraportID:AT3G48270 Length:489 Species:Arabidopsis thaliana


Alignment Length:502 Identity:113/502 - (22%)
Similarity:209/502 - (41%) Gaps:82/502 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALIFLCAILIGFVIYSLI---SSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQH------ 56
            |.....||:|:  ||:..:|   ....:.:|..|.|..:|.:||..|.        |:|      
plant     2 MIMFFLLCSII--FVVTIIIFRKQKRGKKRNTLPSPPGLPLIGNLHQL--------GRHPHRSLC 56

  Fly    57 ILFERWAKDFRSDLVGLKLGREYVVVALGHEMVKEV--QLQEVFEGRPDNFFLRLRTMGTRKGIT 119
            .|..|:     ..|:.|..||..|:|....|:.::|  ....||..||.:..............:
plant    57 SLSHRY-----GPLMLLHFGRVPVLVVSSAELARDVLKTHDRVFASRPRSKIFEKLLYDKHDVAS 116

  Fly   120 CTDGQLWYEHRHFAMKQMRNVG----YGRSQMEHHIELEAEELLGQLERTEEQPIEPV--TWLAQ 178
            ...|:.|        :||::|.    :....:....|:..||:...:|:..:....||  :.:..
plant   117 APYGEYW--------RQMKSVCVLHLFSNKMVRSFREVREEEISLMMEKIRKSISLPVNLSKILV 173

  Fly   179 SVLNVLWCLIA-GKRIARQEDGTLRRLLDLMNRRSKLFDICGGL--LAQFPWLRHVAPDRTGYNL 240
            |:.|.:.|.:| |::...:.|  .:.|::.:|:....|.:...:  ||...|:|       |.:.
plant   174 SLTNDVICKVALGRKYGGETD--FKELMERLNKLLGTFSVGSYVPWLAWIDWIR-------GLDC 229

  Fly   241 -IQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTIL 304
             :::...::..||...:::|     .|.:...:|.:...|...:|::.|.|   .|...:...::
plant   230 QLEKTANDVDKFFERVVQDH-----VDGNRDMTDFVDVLLAIQRDKTVGFE---INRVSIKAIVM 286

  Fly   305 DFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTA---SVAAASTDAFPHLSRREAFDYMDAF 366
            :.|:.|:.|:|..:..|:..|...|...::|..:|..   ..::.|.:...::|      |:.|.
plant   287 NVFVGGTDTSSTLMEWAMTELLRHPKCLKRLQEEVRTICKDKSSVSEEEIQNMS------YLKAV 345

  Fly   367 IMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHW-KDPLEFRPERFIDS 430
            |.|..|.....|:..|..:....:||.:.||....:||:..::..:...| .|..||||||.:||
plant   346 IKEALRLHPPLPLMVPHESTQDVRLGDHHIPAGTQVLINAWAIGREAATWGPDVEEFRPERHLDS 410

  Fly   431 A----GKCFKDEYFMPFGMGRRRCLGDALARACIFS--FLVRIVQHF 471
            :    |:.|:   .:|||.|||.|  .|::.|.:.:  .|..:|..|
plant   411 SVDYRGQAFE---LIPFGSGRRIC--PAISFAVVLNEVVLANLVHRF 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 105/470 (22%)
CYP71A26NP_680106.1 p450 21..481 CDD:299894 106/481 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.