DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71B38

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_190011.1 Gene:CYP71B38 / 823550 AraportID:AT3G44250 Length:499 Species:Arabidopsis thaliana


Alignment Length:509 Identity:130/509 - (25%)
Similarity:220/509 - (43%) Gaps:78/509 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAIL---IGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKDF 66
            ||||.:|   :..:::..:..::  ...||||..:|.:||..|..|         :|::.:.|..
plant     3 IFLCFLLLLPLSLILFKKLLPSK--GKLPPGPIGLPIIGNLHQLGK---------LLYKSFHKIS 56

  Fly    67 R--SDLVGLKLGREYVVVALGHEMVKEVQLQEVFE--GRPDNFFLRLRTMGTRKGITCTDGQLWY 127
            :  ..:|.|:||...|:|....|..:||......|  .||......|.|...:.......|..|.
plant    57 QEYGPVVLLRLGVVPVIVVSSKEGAEEVLKTHDLETCTRPKTAATGLFTYNFKDIGFAPFGDDWR 121

  Fly   128 EHRH------FAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWC 186
            |.|.      |::|::::..|.|   |...||..:::...::.|:...::....|.....:::..
plant   122 EMRKITTLELFSVKKLKSFRYIR---EEESELLVKKISKSVDETQNSSVDLRKVLFSFTASIICR 183

  Fly   187 LIAGKRIARQE--DGTLRRLLDLMNRRSKLFDICGGLLA---QFP--WL------RHVAPDRTGY 238
            |..|:...:.:  |.:|..|  ::...:.|     |..|   .||  ||      :|...::..|
plant   184 LAFGQNFHQCDFVDASLEEL--VLESEANL-----GTFAFADFFPGGWLIDRISGQHSRVNKAFY 241

  Fly   239 NLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAE-SDLIYAYLQEM-KDRSAGGESSTFNETQLVM 301
                    :|..|:...|::|    .|...|.: ||::...|..: |...|.....|::..:.||
plant   242 --------KLTNFYKHVIDDH----LKTGQPQDHSDIVSVMLDMINKPTKADSFKVTYDHLKGVM 294

  Fly   302 TILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSR-----REAFD 361
            :  |.|:||....:||:...|..|:..|.|.:||..::.|.:.       |:..|     .|..:
plant   295 S--DIFLAGVNGGANTMIWTLTELSRHPRVMKKLQEEIRAMLG-------PNKERITEEDLEKVE 350

  Fly   362 YMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPER 426
            |:...::|..|.....|:..||..:...|:.||:||||..|.|:..::..|.::||.|.||.|||
plant   351 YLKLVMVETFRLHPPAPLLLPRLTMSDIKIQGYNIPKNTMIQINTYAIGRDPKYWKQPGEFIPER 415

  Fly   427 FIDSAGKCFKDEYF--MPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAG 478
            |:||... :|.::|  :|||.|||.|.|.|.....:...|:.::..|...||.|
plant   416 FLDSPID-YKGQHFELLPFGAGRRICPGMATGITMVELGLLNLLYFFDWSLPNG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 125/481 (26%)
CYP71B38NP_190011.1 p450 27..497 CDD:386267 125/483 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.