DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71B3

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_189253.1 Gene:CYP71B3 / 822223 AraportID:AT3G26220 Length:501 Species:Arabidopsis thaliana


Alignment Length:503 Identity:117/503 - (23%)
Similarity:208/503 - (41%) Gaps:69/503 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALI--FLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWA 63
            ||.|:  |...:::..:.......::|  |.||.|..:|.:||..|.|.          ||.|..
plant     1 MSILLYFFFLPVILSLIFMKKFKDSKR--NLPPSPPKLPIIGNLHQLRG----------LFHRCL 53

  Fly    64 KDF---RSDLVGLKLGREYVVVALGHEMVKEVQLQEVFE--GRP-DNFFLRLRTMGTRKGITCTD 122
            .|.   ...::.|:||...:||....|..:||......|  .|| .|...:....|  |.|....
plant    54 HDLSKKHGPVLLLRLGFIDMVVISSKEAAEEVLKVHDLECCTRPKTNASSKFSRDG--KDIAFAP 116

  Fly   123 -GQLWYEHR------HFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSV 180
             |::..|.|      .|:.:::|:..|.|       |.|.:.::.:|:.:.::  :....|:|::
plant   117 YGEVSRELRKLSLINFFSTQKVRSFRYIR-------EEENDLMVKKLKESAKK--KNTVDLSQTL 172

  Fly   181 LNVLWCLI----AGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQ--FP----WLRHVAPDR 235
            ..::..:|    .|:|:.:.:.....::.:||....|:    |.|.:.  ||    |.......|
plant   173 FYLVGSIIFRATFGQRLDQNKHVNKEKIEELMFEVQKV----GSLSSSDIFPAGVGWFMDFVSGR 233

  Fly   236 TGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLV 300
              :..:.::..|:.......|:.|.:......:....|:|.:.|:.:. :....||.......|.
plant   234 --HKTLHKVFVEVDTLLNHVIDGHLKNPEDKTNQDRPDIIDSILETIY-KQEQDESFKLTIDHLK 295

  Fly   301 MTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFD---Y 362
            ..|.:.::||..|::.|:..|:..|...|.|.:|...::...:.....:..    ..|..|   |
plant   296 GIIQNIYLAGVDTSAITMIWAMAELVKNPRVMKKAQEEIRTCIGIKQKERI----EEEDVDKLQY 356

  Fly   363 MDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERF 427
            :...|.|..|.....|:..||..:...|:.|||||:...:|::..|:..:.|.|::|.||.||||
plant   357 LKLVIKETLRLHPPAPLLLPRETMADIKIQGYDIPRKTILLVNAWSIGRNPELWENPEEFNPERF 421

  Fly   428 IDS----AGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHF 471
            ||.    .|..|:   .:|||.||:.|.|.|...|.:...|:.::.:|
plant   422 IDCPMDYKGNSFE---MLPFGSGRKICPGIAFGIATVELGLLNLLYYF 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 111/472 (24%)
CYP71B3NP_189253.1 p450 1..500 CDD:386267 117/503 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.