DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP71B21

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_189250.1 Gene:CYP71B21 / 822220 AraportID:AT3G26190 Length:499 Species:Arabidopsis thaliana


Alignment Length:545 Identity:130/545 - (23%)
Similarity:207/545 - (37%) Gaps:149/545 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAIL---IGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKDF 66
            ||||.:|   :..|.|..:..::  ...||||..:|.:||..|..|..      |..|.:.::::
plant     3 IFLCFLLLLPLFLVFYKRLLPSK--GKLPPGPISLPIIGNLHQLGKSL------HRSFYKLSQEY 59

  Fly    67 RSDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMG----TRKGITCTD----- 122
             ..::.|:.|...|||....|..:||                |:|..    ||..::.|.     
plant    60 -GPVMFLRFGVVPVVVFSTKEAAEEV----------------LKTHDLETCTRPKLSATGLFTYN 107

  Fly   123 ---------GQLWYEHRHFAMKQMRNVGYGRSQME--HHIELEAEELLGQLERTEEQPIEPVTWL 176
                     |:.|.|.|..||.::    :...:::  .:|..|..|||          ::.||..
plant   108 FKDIGFAQYGEDWREMRKLAMLEL----FSSKKLKAFRYIREEESELL----------VKKVTES 158

  Fly   177 AQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQ----------------- 224
            ||:                      :.|:||   |..||.....::.:                 
plant   159 AQT----------------------QTLVDL---RKALFSYTASIVCRLAFGQNFHECDFVDMDK 198

  Fly   225 --------------------FP----WLRHVAPDRTG--YNLIQQLNTELYGFFMDTIEEHRRQL 263
                                ||    |    |.||..  ::.:.:....|..||...|::|   |
plant   199 VEELVLESETNLGSFAFIDFFPAGLGW----AIDRISGQHSRLHKAFARLSNFFQHVIDDH---L 256

  Fly   264 AKDPSPAESDLIYAYLQEM-KDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAM 327
            ....|...||::...|..: |:...|....|::..:.||:  |.|:||....:.|:..||..|..
plant   257 KPWQSEDHSDIVGVMLDMINKESKVGSFKVTYDHLKGVMS--DVFLAGVNAGAITMIWALTELTR 319

  Fly   328 RPDVQEKLFSQVTASVAAASTDAFPHLSRR--EAFDYMDAFIMEVQRFFHITPITGPRRALWATK 390
            .|.|.:||..::...:.    |....::.:  |...|:...|.|..|.....|:..||..:...|
plant   320 HPRVMKKLQQEIRELLG----DNKEKITEQDLEKVHYLKLVIQETFRLHPPAPLLLPRETMSDVK 380

  Fly   391 LGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFKDEYF--MPFGMGRRRCLGD 453
            :.||:||||..|.|:..::..|...|.:|.||.||||:||... :|.::|  :|||.|||.|.|.
plant   381 IQGYNIPKNTMIEINTYAIGRDPNCWTNPNEFIPERFVDSPID-YKGQHFELLPFGGGRRICPGM 444

  Fly   454 ALARACIFSFLVRIVQHFSVVLPAG 478
            |.....:...|:.::..|...||.|
plant   445 ATGMTIVELGLLNVLYFFDWSLPYG 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 123/517 (24%)
CYP71B21NP_189250.1 p450 27..498 CDD:299894 123/519 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.