DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP705A20

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_188646.1 Gene:CYP705A20 / 821554 AraportID:AT3G20110 Length:510 Species:Arabidopsis thaliana


Alignment Length:407 Identity:86/407 - (21%)
Similarity:162/407 - (39%) Gaps:62/407 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEE-------LLGQLERTEEQPI-EPVTWLAQS 179
            |..|    .|..|.:.....|...:|....:.|:|       ||.:..:.|...| :..|.|:  
plant   129 GDYW----KFMKKLLVTKLLGPQALERSRSIRADELERFYRSLLDKAMKKESVEIGKEATKLS-- 187

  Fly   180 VLNVLWCLIAGKRIARQEDGTLRRL------LDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGY 238
             :|.: |.::..|...:|.|...|:      ||.:.::..|.:|     .::|            
plant   188 -INSI-CRMSMGRSFSEESGEAERVRGLVTELDGLTKKVLLVNI-----LRWP------------ 233

  Fly   239 NLIQQLNTELY--------GFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFN 295
              :::|...|:        ..|.:.:|....:..|.|:..:...:...|.|..:........|.|
plant   234 --LEKLRISLFKKEIMYVSNSFDELLERIIVEREKKPNEHQGTYLMDVLLEAYEDEKAEHKITRN 296

  Fly   296 ETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAF 360
            ..:.:  .::..:.|:.|::.||...:..|....:|.::|..::.:.|..........|.:   .
plant   297 HIKSL--FVELLLGGTDTSAQTIQWTMAELINNRNVLKRLREEIDSVVGETRLIQEKDLPK---L 356

  Fly   361 DYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPE 425
            .|:.:.:.|..|.....|:. .|....:.::.|:.|.:..|::::..:|..|...|:||.||:||
plant   357 PYLQSVVKEGLRLHPPLPLM-VRTFQRSCEMKGFYIAEKTTLVVNAYAVMRDPTTWEDPDEFKPE 420

  Fly   426 RFI--DSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGESPSMVLLPG 488
            ||:  :...:..|   .:.||.|||.|.|..||...|.:.:..:||.|.:.: .|:...|..:.|
plant   421 RFLRQEEERRALK---HIAFGSGRRGCPGSNLATIFIGTAIGTMVQCFDLSI-KGDKVKMDEVGG 481

  Fly   489 ITLT-PKPYKVQFVKRT 504
            :.|| ..|.:...|.||
plant   482 LNLTMAHPLECILVPRT 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 83/401 (21%)
CYP705A20NP_188646.1 p450 13..500 CDD:299894 86/407 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.