DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and CYP705A8

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:512 Identity:118/512 - (23%)
Similarity:205/512 - (40%) Gaps:97/512 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIFLCAILIGFVIYSLISSARRPK---NFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKD 65
            ||.||  |:..:.||..  .::||   |.||.|..:|.:|:.            .|:|.....:.
plant    15 LILLC--LLSILCYSFF--FKKPKDGFNLPPSPPSLPIIGHL------------HHLLSLFMHRS 63

  Fly    66 FRSDLVGLKLGREYVVVALGHEMVKEVQL-------QEVFEGRPDNFFLRLRTMGTRKG------ 117
            .:      ||..:|..:...|.....:.|       .|:|..:..|  :..|...|.:|      
plant    64 LQ------KLSSKYGPLLYLHVFNVPILLVSSPSIAYEIFRAQDVN--VSTRDFPTNEGSLFLGS 120

  Fly   118 ---ITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEE-------LLGQLERTEEQPIEP 172
               ||...|:.|    .|..|.:.....|...:|....:.|.|       ||.:..:.|...|..
plant   121 FSFITAPYGEYW----KFMKKLIVTKLLGPQALERSQRIRANEVERFYSNLLDKAMKKESVEIAD 181

  Fly   173 VTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTG 237
            .   |..::|.:.|.:...|...:|:|...|:..|:.:...|  :...|||..  ||... .:.|
plant   182 E---AMKLVNNIICKMIMGRTCSEENGEAERIRGLVTKSDAL--LKKFLLAAI--LRKPL-KKIG 238

  Fly   238 YNLIQQLNTELYGFFMDTIE----EHRRQLAKDPSPAE--SDLIYAYLQEMKDRSAGGESSTFNE 296
            ..|.:::..::...|.:.:|    |:..:|.::....:  ..|:..|         |.::|.:..
plant   239 ITLFKKVFMDISLKFDEVLEKILVENEERLEENQQGTDIMDKLLEVY---------GDKTSEYKI 294

  Fly   297 TQ--LVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAA----STDAFPHLS 355
            |:  :....:|.|.||:.|.::||...:..:.....:.|:|..::.:.|...    .|| .|:|.
plant   295 TRDHIKSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVVGKTRLIQETD-LPNLL 358

  Fly   356 RREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPL 420
                  |:.|.:.|..|.....|:. .|.......:||:.|||...::::..::..|.::|:|||
plant   359 ------YLQATVKEGLRLHPTIPLV-LRTFQDGCTIGGFSIPKKTKLVVNGYAIMRDPDNWEDPL 416

  Fly   421 EFRPERFIDSAGKCFKDEY------FMPFGMGRRRCLGDALARACIFSFLVRIVQHF 471
            ||:||||:.|:....||..      ::.||.|||.|.|..||...:.:.:..:||.|
plant   417 EFKPERFLASSRSSQKDAIKEEVLKYLSFGSGRRGCPGVNLAYVSVETAIGVMVQCF 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 108/483 (22%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 102/456 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.