DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and Cyp2d5

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_775426.1 Gene:Cyp2d5 / 286963 RGDID:628630 Length:504 Species:Rattus norvegicus


Alignment Length:488 Identity:149/488 - (30%)
Similarity:240/488 - (49%) Gaps:36/488 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RRPKNFPPGPRFVPW--LGNTLQFRKEASAVGGQHILFERWAKDFR-SDLVGLKLGREYVVVALG 85
            |....:||||  |||  |||.||       |...::.:..:....| .|:..|::|.:.:|:...
  Rat    31 RWTSRYPPGP--VPWPVLGNLLQ-------VDPSNMPYSMYKLQHRYGDVFSLQMGWKPMVIVNR 86

  Fly    86 HEMVKEVQL---QEVFEGRPDNFFLRLRTMGTRKGIT-CTDGQLWYEHRHFAMKQMRNVGYGRSQ 146
            .:.|:||.:   ::..:..|...|..|......:|:. .:.|..|.|.|.|::..:|..|.|:..
  Rat    87 LKAVQEVLVTHGEDTADRPPVPIFKCLGVKPRSQGVVFASYGPEWREQRRFSVSTLRTFGMGKKS 151

  Fly   147 MEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRR 211
            :|..:..||..|.........:.|.|...|.:::.||:..||..:|. ..||..|.|:|.|:  .
  Rat   152 LEEWVTKEAGHLCDAFTAQNGRSINPKAMLNKALCNVIASLIFARRF-EYEDPYLIRMLTLV--E 213

  Fly   212 SKLFDICG---GLLAQFPWLRHV--APDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAE 271
            ..|.::.|   .:|..||.|..:  ..|:     :.|.......|..:.:.|:|  ...||:...
  Rat   214 ESLIEVSGFIPEVLNTFPALLRIPGLADK-----VFQGQKTFMAFLDNLLAENR--TTWDPAQPP 271

  Fly   272 SDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLF 336
            .:|..|:|.|: :::.|...|:||:..|.|.::|.|.||..||:.|:..||:::.:.||||.::.
  Rat   272 RNLTDAFLAEV-EKAKGNPESSFNDENLRMVVVDLFTAGMVTTATTLTWALLLMILYPDVQRRVQ 335

  Fly   337 SQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNAT 401
            .::...:.....   |.::.:....|.:|.|.|||||..|.|:..||......::..:.|||..|
  Rat   336 QEIDEVIGQVRC---PEMTDQAHMPYTNAVIHEVQRFGDIAPLNLPRITSCDIEVQDFVIPKGTT 397

  Fly   402 ILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVR 466
            ::|:|.||..|:..|:.||.|.||.|:|:.|...|.|.||||..|||.|||:.|||..:|.|...
  Rat   398 LIINLSSVLKDETVWEKPLRFHPEHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTC 462

  Fly   467 IVQHFSVVLPAGE-SPSMVLLPGITLTPKPYKV 498
            ::||||..:|||: .||.:....|::.|.||::
  Rat   463 LLQHFSFSVPAGQPRPSTLGNFAISVAPLPYQL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 148/482 (31%)
Cyp2d5NP_775426.1 p450 37..496 CDD:278495 148/482 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.