DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and Cyp2g1

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_036919.1 Gene:Cyp2g1 / 25251 RGDID:2477 Length:494 Species:Rattus norvegicus


Alignment Length:524 Identity:157/524 - (29%)
Similarity:256/524 - (48%) Gaps:63/524 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKDFRSD 69
            ||:...|...:|........|....||||..:|:|||.||.|.:|:               |:| 
  Rat     9 IFMTLCLSCLLILIAWKRTSRGGKLPPGPTPIPFLGNLLQVRIDAT---------------FQS- 57

  Fly    70 LVGLKLGREY------------VVVALGHEMVKEVQLQEV--FEGRPDNFFLRLRTMGTRKGITC 120
              .|||.::|            ||:..|||.|||..:.:.  |.||.:...|.....|  .|:..
  Rat    58 --FLKLQKKYGSVFTVYFGPRPVVILCGHEAVKEALVDQADDFSGRGEMPTLEKNFQG--YGLAL 118

  Fly   121 TDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLW 185
            ::|:.|...|.|::..:||.|.|:..:|..|:.||..||.:|.:.:..||:|..:|:::|.||:.
  Rat   119 SNGERWKILRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEELHKVKGAPIDPTFYLSRTVSNVIC 183

  Fly   186 CLIAGKRIARQEDGTLRRLLDLMNRR--------SKLFDICGGLLAQFPWLRHVAPDRTGYNLIQ 242
            .::.|||. ..||...|.|:.::|..        ::|:|:..|::..||. ||   :|. ||||:
  Rat   184 SVVFGKRF-DYEDQRFRSLMKMINESFVEMSMPWAQLYDMYWGVIQYFPG-RH---NRL-YNLIE 242

  Fly   243 QLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEM-KDRSAGGESSTFNETQLVMTILDF 306
                ||..|....::.:  :.:.|||... |.|..:|.:| :|:|  ...|.||...||:|.|:.
  Rat   243 ----ELKDFIASRVKIN--EASFDPSNPR-DFIDCFLIKMYQDKS--DPHSEFNLKNLVLTTLNL 298

  Fly   307 FIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQ 371
            |.||::|.|:|:....::|...|:|:.|:..::...:....|   |.:..|....|.||.|.|:|
  Rat   299 FFAGTETVSSTLRYGFLLLMKYPEVEAKIHEEINQVIGTHRT---PRVDDRAKMPYTDAVIHEIQ 360

  Fly   372 RFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFK 436
            |...|.|:..|...:..|...||.:||...:...:.||..|.::::.|..|.|:.|:|..|:..|
  Rat   361 RLTDIVPLGVPHNVIRDTHFRGYFLPKGTDVYPLIGSVLKDPKYFRYPEAFYPQHFLDEQGRFKK 425

  Fly   437 DEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSV--VLPAGESPSMVLLPGITLTPKPYKVQ 499
            ::.|:.|..|:|.|:|:||||..:|.:...|:|.||:  ::|..:......:.|....|..|::.
  Rat   426 NDAFVAFSSGKRICVGEALARMELFLYFTSILQRFSLRSLVPPADIDIAHKISGFGNIPPTYELC 490

  Fly   500 FVKR 503
            |:.|
  Rat   491 FMAR 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 150/494 (30%)
Cyp2g1NP_036919.1 p450 34..491 CDD:278495 150/494 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.