DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and Cyp2ac1

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_017452383.2 Gene:Cyp2ac1 / 108351992 RGDID:1564244 Length:499 Species:Rattus norvegicus


Alignment Length:539 Identity:152/539 - (28%)
Similarity:234/539 - (43%) Gaps:90/539 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALIFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHIL--------F 59
            ||:.|..||| ..|...::.|.: :..||||:  ||           ..:|..|||        .
  Rat    11 ALLGLILILI-LNIKDFMAKASK-RQCPPGPK--PW-----------PVIGNLHILNLKRPYQTM 60

  Fly    60 ERWAKDFRSDLVGLKLGREYVVVALGHEMVKEVQL---------------QEVFEGRPDNFFLRL 109
            ...:|.: ..:..:::|...|||..|:|.||:..:               :.:|:|         
  Rat    61 LELSKKY-GPIYSIQMGPRKVVVLSGYETVKDALVNYGNQFGERSQVPIFERLFDG--------- 115

  Fly   110 RTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVT 174
                  |||....|:.|...|.|::..:|:.|.|:..:|..|.:|.:.|:...|..:.:|.|...
  Rat   116 ------KGIAFAHGETWKTMRRFSLSTLRDFGMGKRTIEDTIVVECQHLIQSFESHKGKPFEIKR 174

  Fly   175 WLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKL-----------FDICGGLLAQFPWL 228
            .|..||.||:..::.|||. ..||....|||.|:....||           |.|.|.||      
  Rat   175 VLNASVANVIVSMLLGKRF-DYEDPQFLRLLTLIGENIKLIGNPSIVLFNIFPILGFLL------ 232

  Fly   229 RHVAPDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESST 293
                   ..:..:.:...||:.|...|..||...|.|:...:..|......||..::||    ..
  Rat   233 -------RSHKKVLRNRDELFSFIRRTFLEHCHNLDKNDPRSFIDAFLVKQQEENNKSA----DY 286

  Fly   294 FNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRRE 358
            |||..|:..:.:.|.||::||:.|:...::::...|:||:|:..::...|.:|.    |.:..|.
  Rat   287 FNEENLLALVSNLFTAGTETTAATLRWGIILMMRYPEVQKKVHDEIHKVVGSAQ----PRIEHRT 347

  Fly   359 AFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFR 423
            ...|.||.|.|:||..:|.|.:.|...........|.|||...::..|.||..|:..|:.|..|.
  Rat   348 QMPYTDAVIHEIQRVANILPTSLPHETSTDVVFKNYYIPKGTEVITLLTSVLRDQTQWETPDAFN 412

  Fly   424 PERFIDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGES-PSMVLLP 487
            |..|:.|.|:..|.|.||||.:|||.|.|:.||:..:|.|...::|.|:...|.|.| ..:.|.|
  Rat   413 PAHFLSSKGRFVKKEAFMPFSVGRRMCAGEPLAKMELFLFFTSLMQKFTFQPPPGVSYLDLDLTP 477

  Fly   488 --GITLTPKPYKVQFVKRT 504
              |.|:.|.|:|:..:.||
  Rat   478 DIGFTIQPLPHKICALLRT 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 142/506 (28%)
Cyp2ac1XP_017452383.2 cytochrome_P450 67..490 CDD:425388 130/460 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.