DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp305a1 and XB5798854

DIOPT Version :9

Sequence 1:NP_649151.1 Gene:Cyp305a1 / 40161 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001120076.1 Gene:XB5798854 / 100145084 XenbaseID:XB-GENE-5798855 Length:497 Species:Xenopus tropicalis


Alignment Length:503 Identity:139/503 - (27%)
Similarity:216/503 - (42%) Gaps:67/503 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKDFRSD 69
            |||..:|.   :.||....:|....||||..||.||......::.         ..|:..:|.. 
 Frog    12 IFLLTLLF---LSSLWRQQKRSHVLPPGPTPVPLLGTPNYLTRDG---------IVRYYPEFHK- 63

  Fly    70 LVGLKLGREY--------VVVALGHEMVKEVQLQ--EVFEGRPDNFFLRLRTMGTRKGIT-CTDG 123
                |.|:.:        |||..|:|.||:..:.  |.|..||:...:...|    ||.| .:..
 Frog    64 ----KYGKMFTVWQMADPVVVLCGYETVKDALINHAEQFSDRPEYPVIDSYT----KGFTFVSAN 120

  Fly   124 QLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLI 188
            ..|.:.|.:.:..:||:|.|:..:|...:.|||:|:..:.....:|..|...|..:|.|::..::
 Frog   121 DHWPQFRRYILTTLRNIGVGKQTLEEKSQKEAEQLVQAMSEMGGKPFNPSHLLGCAVSNIIGAVL 185

  Fly   189 AGKRIARQEDGTLRRLLDLM--------NRRSKLFDICG--GLLAQFPWLRHVAPDRTGYNLIQQ 243
            .|:::..::    ::||||:        |..|....||.  ..|.:.|:|..:         |.:
 Frog   186 FGQQLDYRD----KKLLDLITNIRKHVSNVLSMKHQICNMFPFLLKLPYLGQI---------IMK 237

  Fly   244 LNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFI 308
            .:..|..:..:.::.|:..|  |.:....|.|..:|.::|:.|. .|.:.|:|..|.|......|
 Frog   238 NSLYLVDYVREQLDFHKETL--DIAAPPRDFIDHFLLKIKEESR-KEGTKFHELSLTMYSSGLLI 299

  Fly   309 AGSQTTSNTINLALMVLAMRPDVQEKL---FSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEV 370
            ||..||::|:...:.|:|..|.:|.|:   ...||.|...      |.:|.|....|.:|.|.|:
 Frog   300 AGVDTTTSTLKFCVTVIAHLPHIQAKVQREIDDVTGSQRP------PGMSDRAQMPYTNAVIHEL 358

  Fly   371 QRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCF 435
            ||...:.|..........|:..||..||...||..|.||..|...|:.|.||.|..|:|..|:..
 Frog   359 QRHLDLAPAALFHALREDTEFHGYTFPKGTRILPYLSSVLFDPSQWETPDEFNPGHFLDEKGQFR 423

  Fly   436 KDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGESPSM 483
            ....||.|..|:|.|||.:|||..||.|...::|.||:....|....|
 Frog   424 AKPAFMVFSAGKRECLGVSLARMEIFLFFSALLQKFSLCPTTGAQMDM 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 132/478 (28%)
XB5798854NP_001120076.1 p450 34..461 CDD:278495 129/466 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.