DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and SPAG6

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_036575.1 Gene:SPAG6 / 9576 HGNCID:11215 Length:509 Species:Homo sapiens


Alignment Length:499 Identity:94/499 - (18%)
Similarity:191/499 - (38%) Gaps:104/499 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 MADSSTGGQNEEAAGSGAQPSVINEEMIQMLFSGRENEQLEATQKFRKLLSRDPNPPIEEVIQKG 137
            :|:.:|..||.|...:....|::...::.::.:.::...|...:     |:...:...|.|::..
Human    24 VAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGR-----LANYNDDLAEAVVKCD 83

  Fly   138 IVPQFV-------TFLRNSANATLQ----------------------------FE------AAWT 161
            |:||.|       .|.:.:|...|:                            |:      |||.
Human    84 ILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWA 148

  Fly   162 LTNIASGTSQQTKVVIEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEP 226
            |..||...::.::.|::|||||:.:..:..|...::..|..||.:||..||.....::.:|.:..
Human   149 LRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAH 213

  Fly   227 LLHVLSNSDRITMIRNAVWTLSNLCRGKSPPADFAKI---SHGLPILARLLKYTDADVLSDTCWA 288
            |..::.|.|  ..:::.:  ||.|.:......|.|::   :...|::...||..|..|..:....
Human   214 LAQMILNPD--AKLKHQI--LSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTL 274

  Fly   289 IGYLSDGPNDKIQAVIDAGVCRRLVELLLHPQQNVSTAALRAVGNIVTGDDQQTQVIL---GYNA 350
            |..::....:..|.|::||....:::.:...:.|.....:..:|.:....:.....::   |...
Human   275 IREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQ 339

  Fly   351 LT-CISHLLHSTAETIKKESCWTISNIAAGNREQIQALINANIFPQLMVIMQTAE------FKTR 408
            |: |:|   ....:.||..:.|.:..|.....|..:|:...|..|.|:.:..:.|      .|::
Human   340 LSVCLS---EEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSK 401

  Fly   409 KEAAWAITNATSSGTHEQIHYLVQVGCVPPMCDFLTVVDSDIVQVALNALENIL----KAGEKFQ 469
            |    ||.|.....|:           :|.:..||.....:|::..:.....:|    ||...|.
Human   402 K----AIKNILQKCTY-----------LPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFV 451

  Fly   470 TRPNPYAITIEECGGLDKIEYLQAHENRDIYHKSFYIIEQYFGN 513
            |           .|||.|::.::|....        ::::|..:
Human   452 T-----------SGGLKKVQEIKAEPGS--------LLQEYINS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 94/499 (19%)
IBB 3..116 CDD:280005 7/42 (17%)
ARM 131..252 CDD:237987 37/161 (23%)
armadillo repeat 133..165 CDD:293788 13/72 (18%)
armadillo repeat 173..209 CDD:293788 11/35 (31%)
armadillo repeat 215..250 CDD:293788 6/34 (18%)
ARM 264..378 CDD:237987 20/117 (17%)
armadillo repeat 267..292 CDD:293788 6/24 (25%)
armadillo repeat 300..336 CDD:293788 6/35 (17%)
armadillo repeat 342..376 CDD:293788 7/37 (19%)
ARM 356..461 CDD:237987 20/110 (18%)
armadillo repeat 384..421 CDD:293788 10/42 (24%)
armadillo repeat 427..461 CDD:293788 4/33 (12%)
Arm_3 473..517 CDD:292804 6/41 (15%)
SPAG6NP_036575.1 ARM 1 31..70 6/43 (14%)
armadillo repeat 37..68 CDD:293788 2/35 (6%)
ARM 2 73..112 9/38 (24%)
armadillo repeat 78..110 CDD:293788 8/31 (26%)
SRP1 112..>423 CDD:227396 65/332 (20%)
ARM 3 115..154 6/38 (16%)
armadillo repeat 120..152 CDD:293788 5/31 (16%)
ARM 4 157..196 11/38 (29%)
armadillo repeat 160..196 CDD:293788 11/35 (31%)
ARM 5 199..238 8/42 (19%)
armadillo repeat 202..234 CDD:293788 6/35 (17%)
ARM 6 241..280 8/38 (21%)
armadillo repeat 244..278 CDD:293788 7/33 (21%)
HEAT repeat 289..325 CDD:293787 5/35 (14%)
ARM 7 325..365 8/42 (19%)
HEAT repeat 335..369 CDD:293787 8/36 (22%)
ARM 8 368..409 11/44 (25%)
HEAT repeat 378..406 CDD:293787 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.