DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and alphaKap4

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster


Alignment Length:395 Identity:120/395 - (30%)
Similarity:204/395 - (51%) Gaps:10/395 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KLLSRDPNPPIEEVIQKGIVPQFVTFLRNSANATLQFEAAWTLTNIASGTSQQTKVVIEAGAVPI 184
            ||.|.:..|.:.::::...:...|..|.:.....::.:||..|.:||||:|:.:.::.:|||||.
  Fly    45 KLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVPR 109

  Fly   185 FIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLLHVLSNSDRIT-MIRNAVWTLS 248
            .|.||.||..:|.|:.:.:|||:...:|..||:::..|:::.|:.::.:....| |:.:..|.|.
  Fly   110 LIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLR 174

  Fly   249 NLCRGK--SPPADFAKISHGLPILARLLKYTDADVLSDTCWAIGYLSDGPNDKIQAVIDAGVCRR 311
            .||...  |||.:.|:|...|.|   :|...:|:||.|...|:..|:.| |:.||.::|..|..|
  Fly   175 KLCISSQPSPPDNAAEIIQALNI---VLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPR 235

  Fly   312 LVELLLHPQQNVSTAALRAVGNIVTGDDQQTQVILGYNALTCISHLLHSTAETIKKESCWTISNI 376
            ::.||.||...|..|||:|:.||.||.::|.|.:|..|.|..:|.|:.::...|:.:....:.||
  Fly   236 IIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNI 300

  Fly   377 AAGNREQIQALINANIFPQLMVIMQTAEFKTRKEAAWAITNATSSGTHEQIHYLVQVGCVPPMCD 441
            |.||..|..|::||.:..:::..::......:..||..||..........:.||::.|.:|..|:
  Fly   301 ADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCN 365

  Fly   442 FLTVVDSDIVQVALNALENILKAGEKFQTRPNPYAITIEECGGLDKIEYLQAHENRDIYHKSFYI 506
            .|...:.||:...|:.|..:|.....|....:.   .||..|.|:.|..||:.|:.:|...:..|
  Fly   366 LLFCQERDILSNVLDILSTMLDVDPSFSAEVSG---IIEWSGALNNIRMLQSSEHEEIAAVARKI 427

  Fly   507 IEQYF 511
            |..||
  Fly   428 IGNYF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 120/395 (30%)
IBB 3..116 CDD:280005
ARM 131..252 CDD:237987 35/121 (29%)
armadillo repeat 133..165 CDD:293788 5/31 (16%)
armadillo repeat 173..209 CDD:293788 15/35 (43%)
armadillo repeat 215..250 CDD:293788 8/35 (23%)
ARM 264..378 CDD:237987 39/113 (35%)
armadillo repeat 267..292 CDD:293788 8/24 (33%)
armadillo repeat 300..336 CDD:293788 16/35 (46%)
armadillo repeat 342..376 CDD:293788 7/33 (21%)
ARM 356..461 CDD:237987 25/104 (24%)
armadillo repeat 384..421 CDD:293788 7/36 (19%)
armadillo repeat 427..461 CDD:293788 10/33 (30%)
Arm_3 473..517 CDD:292804 13/39 (33%)
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 34/119 (29%)
armadillo repeat 98..134 CDD:293788 15/35 (43%)
armadillo repeat 140..176 CDD:293788 8/35 (23%)
ARM 189..301 CDD:237987 40/115 (35%)
armadillo repeat 192..217 CDD:293788 8/27 (30%)
armadillo repeat 224..260 CDD:293788 16/35 (46%)
armadillo repeat 266..300 CDD:293788 7/33 (21%)
ARM 276..385 CDD:237987 26/108 (24%)
armadillo repeat 308..342 CDD:293788 7/33 (21%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 13/33 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.