DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc58 and alms1

DIOPT Version :9

Sequence 1:NP_730454.2 Gene:Ccdc58 / 40159 FlyBaseID:FBgn0036909 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_690375.6 Gene:alms1 / 561882 ZFINID:ZDB-GENE-030131-4837 Length:2105 Species:Danio rerio


Alignment Length:149 Identity:31/149 - (20%)
Similarity:56/149 - (37%) Gaps:40/149 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MRDVDDKIIYALNALPTESFKGQVNSESTCRDLYAKLQESHLARQESIR--SCITISAS------ 74
            :|::::::...|...|:       |..||.:||.||:.|..|....|.:  :.||||.:      
Zfish  1182 LRNMENRLSDQLQKAPS-------NPLSTVQDLEAKVHEIALREGFSTKPFTSITISTTRRTPSP 1239

  Fly    75 ------------NLKKLREKRETQPDDVDTDNQFRAEQRKL-RVLQAELNVEDIIKDRSYK---- 122
                        .:..:....||.....|:|.:...|.:.: .....|...|:.|.|::.:    
Zfish  1240 QSPPHSPVTGTLKITNVGSANETPAGTKDSDREKETEGQHIDEKKTTEDKQENTITDKAQRMSHI 1304

  Fly   123 -------TFNERCR-SYFH 133
                   |||.:.. |:.|
Zfish  1305 DYNVTSSTFNNKSHLSHIH 1323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc58NP_730454.2 Cid2 5..128 CDD:286815 29/141 (21%)
alms1XP_690375.6 ALMS_motif 1980..2101 CDD:291955
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.